Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IHC detected in | mouse brain tissue, human cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
11829-1-AP targets ARPP-21 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2399 Product name: Recombinant human ARPP-21 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC017805 Sequence: MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQTL Predict reactive species |
Full Name | cyclic AMP-regulated phosphoprotein, 21 kD |
Calculated Molecular Weight | 89 kDa |
Observed Molecular Weight | 86 kDa |
GenBank Accession Number | BC017805 |
Gene Symbol | ARPP-21 |
Gene ID (NCBI) | 10777 |
RRID | AB_2877798 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9UBL0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ARPP-21 antibody 11829-1-AP | Download protocol |
IHC protocol for ARPP-21 antibody 11829-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Cell Dev Biol PERK Signaling Controls Myoblast Differentiation by Regulating MicroRNA Networks. | ||
Nat Commun The thymocyte-specific RNA-binding protein Arpp21 provides TCR repertoire diversity by binding to the 3'-UTR and promoting Rag1 mRNA expression |