Tested Applications
| Positive WB detected in | mouse liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27270-1-AP targets AS3MT in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26194 Product name: Recombinant human AS3MT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_020682 Sequence: MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTG Predict reactive species |
| Full Name | arsenic (+3 oxidation state) methyltransferase |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 39-41 kDa |
| GenBank Accession Number | NM_020682 |
| Gene Symbol | AS3MT |
| Gene ID (NCBI) | 57412 |
| RRID | AB_2880824 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HBK9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for AS3MT antibody 27270-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Biol Trace Elem Res Overexpression of As3mt Attenuates Sodium Arsenite Induced Ferritinophagy and Hepatic Lipid Accumulation in Mice. | ||
Talanta Speciation analysis reveals intracellular distribution of arsenicals among subcellular organelles of arsenic-methylated human cells exposed to arsenite. |

