Tested Applications
Positive WB detected in | mouse small intestine tissue |
Positive IP detected in | mouse kidney tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 17 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
25245-1-AP targets SLC10A2/ASBT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, hamster |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18808 Product name: Recombinant human SLC10A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 292-348 aa of BC130523 Sequence: IYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK Predict reactive species |
Full Name | solute carrier family 10 (sodium/bile acid cotransporter family), member 2 |
Calculated Molecular Weight | 348 aa, 38 kDa |
Observed Molecular Weight | 38-40 kDa |
GenBank Accession Number | BC130523 |
Gene Symbol | ASBT |
Gene ID (NCBI) | 6555 |
RRID | AB_2879986 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q12908 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC10A2 also known as ASBT, ISBT, and NTCP2, is a sodium/bile acid cotransporter that is primarily responsible for the uptake of bile acids by apical cells in the distal ileum(PMID: 8661017). Mutations in SLC10A2 cause primary bile acid malabsorption (PBAM) and may be associated with other diseases of the liver and intestines, such as familial hypertriglyceridemia (FHTG)(PMID: 9109432).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC10A2/ASBT antibody 25245-1-AP | Download protocol |
IP protocol for SLC10A2/ASBT antibody 25245-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Gastroenterology Solute Carrier Organic Anion Transporter Family Member 3A1 Is a Bile Acid Efflux Transporter in Cholestasis. | ||
Nat Commun Hypothalamic SLC7A14 accounts for aging-reduced lipolysis in white adipose tissue of male mice | ||
Pharmacol Res Geniposide reduces cholesterol accumulation and increases its excretion by regulating the FXR-mediated liver-gut crosstalk of bile acids. | ||
Mol Nutr Food Res The Effect of Coenzyme Q10 Supplementation on Bile Acid Metabolism: Insights from Network Pharmacology, Molecular Docking, and Experimental Validation | ||
J Agric Food Chem Novel Metabolic Regulation of Bile Acid Responses to Low Cholesterol in Whole-Grain-Diet-Fed Mice. | ||
Food Funct Apple polyphenol extract modulates bile acid metabolism and gut microbiota by regulating the circadian rhythms in daytime-restricted high fat diet feeding C57BL/6 male mice. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hua (Verified Customer) (12-01-2020) | It does not work as expected.
![]() |