Tested Applications
| Positive WB detected in | mouse small intestine tissue |
| Positive IP detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 19 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
25245-1-AP targets SLC10A2/ASBT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18808 Product name: Recombinant human SLC10A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 292-348 aa of BC130523 Sequence: IYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK Predict reactive species |
| Full Name | solute carrier family 10 (sodium/bile acid cotransporter family), member 2 |
| Calculated Molecular Weight | 348 aa, 38 kDa |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC130523 |
| Gene Symbol | ASBT |
| Gene ID (NCBI) | 6555 |
| RRID | AB_2879986 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12908 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC10A2 also known as ASBT, ISBT, and NTCP2, is a sodium/bile acid cotransporter that is primarily responsible for the uptake of bile acids by apical cells in the distal ileum(PMID: 8661017). Mutations in SLC10A2 cause primary bile acid malabsorption (PBAM) and may be associated with other diseases of the liver and intestines, such as familial hypertriglyceridemia (FHTG)(PMID: 9109432).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for SLC10A2/ASBT antibody 25245-1-AP | Download protocol |
| WB protocol for SLC10A2/ASBT antibody 25245-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology Solute Carrier Organic Anion Transporter Family Member 3A1 Is a Bile Acid Efflux Transporter in Cholestasis. | ||
Cell Host Microbe Veillonella intestinal colonization promotes C. difficile infection in Crohn's disease | ||
Nat Commun Hypothalamic SLC7A14 accounts for aging-reduced lipolysis in white adipose tissue of male mice | ||
Pharmacol Res Geniposide reduces cholesterol accumulation and increases its excretion by regulating the FXR-mediated liver-gut crosstalk of bile acids. | ||
Mol Nutr Food Res The Effect of Coenzyme Q10 Supplementation on Bile Acid Metabolism: Insights from Network Pharmacology, Molecular Docking, and Experimental Validation | ||
J Agric Food Chem Novel Metabolic Regulation of Bile Acid Responses to Low Cholesterol in Whole-Grain-Diet-Fed Mice. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hua (Verified Customer) (12-01-2020) | It does not work as expected.
 |
