Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, HeLa cells |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
22258-1-AP targets ASF1B-specific in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17763 Product name: Recombinant human ASF1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-202 aa of BC010014 Sequence: INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI Predict reactive species |
| Full Name | ASF1 anti-silencing function 1 homolog B (S. cerevisiae) |
| Calculated Molecular Weight | 202 aa, 22 kDa |
| Observed Molecular Weight | 20-22 kDa |
| GenBank Accession Number | BC010014 |
| Gene Symbol | ASF1B |
| Gene ID (NCBI) | 55723 |
| RRID | AB_2879051 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NVP2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody specifically reacts with the 19kd ASF1B protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ASF1B-specific antibody 22258-1-AP | Download protocol |
| IHC protocol for ASF1B-specific antibody 22258-1-AP | Download protocol |
| WB protocol for ASF1B-specific antibody 22258-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun RIF1-ASF1-mediated high-order chromatin structure safeguards genome integrity.
| ||
Epigenetics Chromatin Distinct role of histone chaperone Asf1a and Asf1b during fertilization and pre-implantation embryonic development in mice. | ||
Int J Biol Macromol Tannic acid protects against colitis by regulating the IL17 - NFκB and microbiota - methylation pathways | ||
Cancer Lett Activation of the FOXM1/ASF1B/PRDX3 axis confers hyperproliferative and antioxidative stress reactivity to gastric cancer | ||















