Featured Product
KD/KO Validated

ATG12 Polyclonal antibody

ATG12 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11264-1-AP

Publications (19)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

APG12, APG12 like, APG12L, APG12-like, Autophagy-related protein 12

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 11264-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 11264-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HCT 116 using 11264-1-AP
HCT 116 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11264-1-AP
WB result of ATG12 antibody (11264-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ATG12 transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of COLO 320 using 11264-1-AP
COLO 320 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of NIH/3T3 using 11264-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11264-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11264-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11264-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11264-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of PC-3 using 11264-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using ATG12 antibody (11264-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATG12 in ?

Overview

Tested Applications
Product Information
Publications (19)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	PC-3 cells, COLO 320 cells, NIH/3T3 cells, HeLa cells, HCT 116 cells
Positive IHC detected in	human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	PC-3 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11264-1-AP targets ATG12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1791 Product name: Recombinant human ATG12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC012266 Sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG Predict reactive species
Full Name	ATG12 autophagy related 12 homolog (S. cerevisiae)
Calculated Molecular Weight	15 kDa
Observed Molecular Weight	48-55 kDa
GenBank Accession Number	BC012266
Gene Symbol	ATG12
Gene ID (NCBI)	9140
RRID	AB_10807096
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O94817
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.

Protocols

Product Specific Protocols
IF protocol for ATG12 antibody 11264-1-AP	Download protocol
IHC protocol for ATG12 antibody 11264-1-AP	Download protocol
WB protocol for ATG12 antibody 11264-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

ATG12 antibody (Cat# 11264-1-AP) has 19 citations in Autophagy, Advanced Science, Chinese Medical Journal, Journal of Ethnopharmacology, European Journal of Pharmacology, Frontiers in Cell and Developmental Biology, Chemical Biology & Interaction, Cancer Science, Journal of Cellular and Molecular Medicine, Neurochemistry Research, Biology, Journal of Cellular Physiology, Biochemical Journal, International Journal of Biochemistry & Cell Biology, Animal Models and Experimental Medicine, Biology of Reproduction, PLoS ONE, Pharmacology, and Journal of Craniofacial Surgery. Fields include autophagy, cancer, liver disease, neurology, nephrology, reproduction, and dermatology.

Species	Application	Title
human	WB	Autophagy WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway. Authors - Danqiong Liu View Article
human	WB	Adv Sci (Weinh) Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy Authors - Lihao Jin View Article
human	WB	Chin Med J (Engl) MiR-3653 blocks autophagy to inhibit epithelial-mesenchymal transition in breast cancer cells by targeting the autophagy-regulatory genes ATG12 and AMBRA1 Authors - Huachen Song KD Validated View Article
mouse,human	WB	J Ethnopharmacol Licochalcone A promotes autophagy to ameliorate NAFLD by inhibiting the mTOR and regulating ULK1/Beclin1/VPS34 pathway Authors - Jingjing Li View Article
human	WB	Eur J Pharmacol Latcripin-7A from Lentinula edodes C91-3 induces apoptosis, autophagy, and cell cycle arrest at G1 phase in human gastric cancer cells via inhibiting PI3K/Akt/mTOR signaling. Authors - Syed Riaz Ud Din View Article
rat	WB,IF	Front Cell Dev Biol Enhancing autophagy and energy metabolism in the meniscus can delay the occurrence of PTOA in ACLT rat Authors - Huangrong Zhu View Article