Tested Applications
Positive WB detected in | HepG2 cells, mouse liver tissue |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 7 publications below |
IF | See 4 publications below |
Product Information
16483-1-AP targets ATP5I in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, chicken |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9605 Product name: Recombinant human ATP5I protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC003679 Sequence: MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK Predict reactive species |
Full Name | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E |
Calculated Molecular Weight | 69 aa, 8 kDa |
Observed Molecular Weight | 8 kDa |
GenBank Accession Number | BC003679 |
Gene Symbol | ATP5I |
Gene ID (NCBI) | 521 |
RRID | AB_2062052 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P56385 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP5I(ATP synthase subunit e) is also named as ATP5K and belongs to the ATPase e subunit family. The ATP5I gene encodes the e subunit of the mitochondrial ATP synthase Fo complex. Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. Antisense ATP5I in a human HCC cell line inhibited cell growth suggesting that ATP5I acts through the MAP kinase pathway(PMID:11939412).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ATP5I antibody 16483-1-AP | Download protocol |
IHC protocol for ATP5I antibody 16483-1-AP | Download protocol |
IF protocol for ATP5I antibody 16483-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
EBioMedicine Mitochonic Acid 5 (MA-5) Facilitates ATP Synthase Oligomerization and Cell Survival in Various Mitochondrial Diseases. | ||
Front Aging Neurosci Hippocampus-Based Mitochondrial Respiratory Function Decline Is Responsible for Perioperative Neurocognitive Disorders. | ||
Genet Sel Evol The mRNA-lncRNA landscape of multiple tissues uncovers key regulators and molecular pathways that underlie heterosis for feed intake and efficiency in laying chickens | ||
J Proteomics Profiling and identification of new proteins involved in brain ischemia using MALDI-imaging-mass-spectrometry. | ||
Biology (Basel) Mitochondrial Translation Occurs Preferentially in the Peri-Nuclear Mitochondrial Network of Cultured Human Cells. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Yan (Verified Customer) (01-28-2020) | It worked well when I performed western blot in embryonic tissue.
|