Tested Applications
| Positive WB detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21565-1-AP targets ATP8A1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16071 Product name: Recombinant human ATP8A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 430-527 aa of BC109317 Sequence: QNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLN Predict reactive species |
| Full Name | ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 |
| Calculated Molecular Weight | 1164 aa, 131 kDa |
| Observed Molecular Weight | 120 kDa |
| GenBank Accession Number | BC109317 |
| Gene Symbol | ATP8A1 |
| Gene ID (NCBI) | 10396 |
| RRID | AB_10734587 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2Q0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ATP8A1 antibody 21565-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
EMBO J Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase. | ||
Proc Natl Acad Sci U S A AP-3-dependent targeting of flippase ATP8A1 to lamellar bodies suppresses activation of YAP in alveolar epithelial type 2 cells. | ||
Sci Rep Proteomic Analysis and Functional Characterization of P4-ATPase Phospholipid Flippases from Murine Tissues. | ||
Sci Rep PPP1R12A is a recycling endosomal phosphatase that facilitates YAP activation
| ||
iScience Lipid flippase dysfunction as a therapeutic target for endosomal anomalies in Alzheimer's disease. | ||
Clin Proteomics Identification of potential molecular targets for the treatment of cluster 1 human pheochromocytoma and paraganglioma via comprehensive proteomic characterization |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mareike (Verified Customer) (01-17-2025) | The sample must not be boiled before application!
![]() |










