• Featured Product
  • KD/KO Validated

Ataxin 2 Polyclonal antibody

Ataxin 2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 21776-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

ATXN2, SCA2, ATXN 2, ATX2, Ataxin-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, Jurkat cells, Neuro-2a cells
Positive IP detected inHEK-293 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:450-1:1800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21776-1-AP targets Ataxin 2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16470

Product name: Recombinant human Ataxin 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 251-600 aa of BC114546

Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS

Predict reactive species
Full Name ataxin 2
Calculated Molecular Weight 1313 aa, 140 kDa
Observed Molecular Weight 140-150 kDa
GenBank Accession NumberBC114546
Gene Symbol ATXN2
Gene ID (NCBI) 6311
RRIDAB_10858483
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99700
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

 ATXN2 (Ataxin-2) is a eukaryotic RNA‐binding protein that is conserved across species. It contains two LSm domains (RNA binding), a PAM2 motif (association with poly(A)-binding protein), and an N-terminal polyglutamine tract (PMID: 25027299). Ataxin-2 plays crucial roles at different stages of the regulation of posttranslational gene expression. ATXN2 is also directly implicated in the regulation of neural function by influencing specific molecular and cellular pathways. Genetic expansion of a poly‐glutamine tract in human ATXN2 has been linked to several neurodegenerative diseases, where it most likely acts through gain‐of‐function effects.

 What is the molecular weight of ATXN2? 

 The molecular weight varies from 12 to 140 kDa, depending on the isoform.

 What are the isoforms of ATXN2?

 ATXN2 has many isoforms, which differ significantly in length and domain composition.

 What is the subcellular localization of ATXN2?

 According to siRNA-based experiments, it is localized in the cytoplasmic compartment of normal cells, where it mostly associates with the Golgi apparatus and stress granules (PMID: 22508507).

 What is the tissue specificity of ATXN2?

 ATXN2 protein has been detected in various tissues; however, it is most highly expressed and studied in CNS. Significant amounts of this protein can also be detected in the liver and gallbladder.

 What is the molecular function of ATXN2?

 Ataxin-2 is involved in regulating various steps of mRNA translation, including poly‐A tailing, RNA stabilization, microRNA‐dependent gene silencing, and translational activation. All those functions are linked to its interactions with the poly(A)-binding protein. Ataxin-2 is involved in the formation of stress granules and P-bodies. Furthermore, genetic models of ATXN2 loss‐of‐function have underlined the importance of ATXN2 in mTOR signaling and cellular metabolism, which are all crucial for neural homeostasis (PMID: 29869836).

 What is ATXN2's involvement in disease?

 The N-terminal region of ATXN2 normally contains a polyQ stretch of 14-31 residues that can be expanded in the pathogenic state to 32-200 residues. Intermediate length expansions of this tract increase susceptibility to amyotrophic lateral sclerosis (ALS or Lou Gehrig's disease) (PMID: 20740007). Long expansions of this tract result in spinocerebellar ataxia-2 (SCA2), an autosomal dominantly inherited, neurodegenerative disorder (PMID: 29427103). Genome-wide association studies indicate that loss-of-function mutations in this gene are associated with susceptibility to type I diabetes, obesity, and hypertension.



Protocols

Product Specific Protocols
IF protocol for Ataxin 2 antibody 21776-1-APDownload protocol
IHC protocol for Ataxin 2 antibody 21776-1-APDownload protocol
IP protocol for Ataxin 2 antibody 21776-1-APDownload protocol
WB protocol for Ataxin 2 antibody 21776-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules

Authors - Qinqin Cui
mouseIF,WB

Cell

Circadian clocks are modulated by compartmentalized oscillating translation

Authors - Yanrong Zhuang
mouseWB

Mol Cell

Autism-Misregulated eIF4G Microexons Control Synaptic Translation and Higher Order Cognitive Functions.

Authors - Thomas Gonatopoulos-Pournatzis
humanWB,IF

Neuron

Small-Molecule Modulation of TDP-43 Recruitment to Stress Granules Prevents Persistent TDP-43 Accumulation in ALS/FTD.

Authors - Mark Y Fang
humanWB

Sci Adv

Endogenous retrovirus-like proteins recruit UBQLN2 to stress granules and shape their functional biology

Authors - Harihar M Mohan
humanIF

Nat Commun

NUP62 localizes to ALS/FTLD pathological assemblies and contributes to TDP-43 insolubility.

Authors - Amanda M Gleixner

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tatyana (Verified Customer) (01-21-2023)

Very good clean signal in ICC. Labels cytoplasmic stress granules well. Antibody was incubated 2 h at RT at 1:100o dilution and could also be reused.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human / SH-SY5Y cells
Ataxin 2 Antibody Immunofluorescence validation (1:1000 dilution) in Human / SH-SY5Y cells (Cat no:21776-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...