• Featured Product
  • KD/KO Validated

APP/Beta Amyloid Polyclonal antibody

APP/Beta Amyloid Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 25524-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

amyloid precursor protein, APP, A4 amyloid protein, AB40, AB42

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, HAP1 cells, HeLa cells, NCI-H1299 cells, mouse brain tissue, rat brain tissue, C6 cells
Positive IHC detected inhuman gliomas tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25524-1-AP targets APP/Beta Amyloid in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22408

Product name: Recombinant human APP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 653-751 aa of BC065529

Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Predict reactive species
Full Name amyloid beta (A4) precursor protein
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC065529
Gene Symbol APP
Gene ID (NCBI) 351
RRIDAB_2880118
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05067
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aβ derives from APP via proteolytic cleavage by proteases called α-, β- and γ-secretase. The α-secretase cleavage precludes the formation of Aβ, while the β- and γ-cleavages generate APP components with amyloidogenic features. Amyloid beta A4 precursor protein(APP), encoded by APP gene which locate on human chromosome 21q, is a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. APP expressed in all fetal tissues and is pronounced in brain, kidney, heart and spleen, but weak in liver. Defects in APP are the cause of Alzheimer disease type 1 (AD1). Amyloid β (Aβ) precursor protein (APP) is a 100-140 kDa transmembrane glycoprotein that exists as several isoforms. This antibody can recognize several isoforms of both mature and immature amyloid beta (A4) precursor protein, including APP770, APP677, APP695, APP696, APP733, APP751, APP752, and APP639. APP can be cleaved into several chains, this antibody could recognize fragments C99, Amyloid-beta protein 42, Amyloid-beta protein 40, C83, P3(40), C80, Gamma-secretase C-terminal fragment 59, Gamma-secretase C-terminal fragment 57, Gamma-secretase C-terminal fragment 50, C31.

Protocols

Product Specific Protocols
IF protocol for APP/Beta Amyloid antibody 25524-1-APDownload protocol
IHC protocol for APP/Beta Amyloid antibody 25524-1-APDownload protocol
WB protocol for APP/Beta Amyloid antibody 25524-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Clin Invest

Chromosomal 3q amplicon encodes essential regulators of secretory vesicles that drive secretory addiction in cancer

Authors - Xiaochao Tan
mouseIF

Neuron

Loss of PYCR2 Causes Neurodegeneration by Increasing Cerebral Glycine Levels via SHMT2.

Authors - Nathalie Escande-Beillard
humanWB

Small

Brain-Penetration and Neuron-Targeting DNA Nanoflowers Co-Delivering miR-124 and Rutin for Synergistic Therapy of Alzheimer's Disease.

Authors - Qin Ouyang
ratIHC

Biomater Res

Controlled release of Clenbuterol from a hydroxyapatite carrier for the treatment of Alzheimer's Disease

Authors - Yi-Wen Lin
humanWB

J Exp Clin Cancer Res

FOLR2+ macrophage depletion from intestinal metaplasia to early gastric cancer: single-cell sequencing insight into gastric cancer progression

Authors - Yuxin He
mouseIHC

Redox Biol

Cognitive enhancement and neuroprotective effects of OABL, a sesquiterpene lactone in 5xFAD Alzheimer's disease mice model.

Authors - Jiang-Jiang Tang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jorge (Verified Customer) (03-28-2023)

Test to evaluate the efficacy of the antibody. Tested on SH-SY5Y APPswe cells differentiated with 10 uM retic acid for 5 days. DAPT treatment 10 uM for 24h. Cells lysed with RIPA buffer. Loading different protein concentrations (ug). Tricine SDS-PAGE 16% acrylamide gel. Transfered on PVDF membrane. Blocking 5% milk. Dilution 1:4000 in TBS-Tw 0.05%.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: Cell line SHSY5Y APPswe
APP/Beta Amyloid Antibody Western Blot validation (1:4000 dilution) in Cell line SHSY5Y APPswe (Cat no:25524-1-AP)
FH

JIMMY (Verified Customer) (04-15-2019)

This antibody detects APP in the brain of 12 months C57BL/6 mice.

  • Applications: Western Blot,
Loading...
||
New chat Able
正在加载,请稍候...