Filter: AllWBIHC

WB analysis of PC-3 using 20330-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse large intestine using 20330-1-AP
mouse large intestine tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse brain using 20330-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse ovary using 20330-1-AP
mouse ovary tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse skeletal muscle using 20330-1-AP
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IHC staining of human colon cancer using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human colon cancer using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human colon cancer using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human colon cancer using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human ovary using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human ovary using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 40x lens).

B4GALT2 Polyclonal antibody

Name: B4GALT2 Polyclonal antibody
Brand: Proteintech
SKU: 20330-1-AP

B4GALT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20330-1-AP

Publications(2)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

B4Gal T2, B4Gal T3, B4GALT2, Beta 1,4 GalTase 2, beta4Gal T2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	PC-3 cells, mouse brain tissue, mouse large intestine tissue, mouse ovary tissue, mouse skeletal muscle tissue
Positive IHC detected in	human colon cancer tissue, human ovary tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 1 publications below
IHC	See 1 publications below

Product Information

20330-1-AP targets B4GALT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14046 Product name: Recombinant human B4GALT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-176 aa of BC002431 Sequence: PGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMD Predict reactive species
Full Name	UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Calculated Molecular Weight	372 aa, 42 kDa
Observed Molecular Weight	42-45 kDa
GenBank Accession Number	BC002431
Gene Symbol	B4GALT2
Gene ID (NCBI)	8704
RRID	AB_10693615
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O60909
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for B4GALT2 antibody 20330-1-AP	Download protocol
WB protocol for B4GALT2 antibody 20330-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Front Genet Identification of a Novel Glycosyltransferase Prognostic Signature in Hepatocellular Carcinoma Based on LASSO Algorithm. Authors - Zhiyang Zhou View Article
human	IHC	J Immunother Cancer Novel post-translational modification learning signature reveals B4GALT2 as an immune exclusion regulator in lung adenocarcinoma Authors - Pengpeng Zhang View Article