Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
23854-1-AP targets BCHE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20888 Product name: Recombinant human BCHE protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 539-602 aa of BC008396 Sequence: MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL Predict reactive species |
| Full Name | butyrylcholinesterase |
| Calculated Molecular Weight | 602 aa, 68 kDa |
| Observed Molecular Weight | 85-90 kDa |
| GenBank Accession Number | BC008396 |
| Gene Symbol | BCHE |
| Gene ID (NCBI) | 590 |
| RRID | AB_2879341 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P06276 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCHE(butyrylcholinesterase) is an enzyme expressed in most human tissues. It may have a greater role in cholinergic transmission than previously surmised, making BChE inhibition an important therapeutic goal in Alzheimer's disease(PMID:11848688). BCHE is also named as CHE1 and belongs to the type-B carboxylesterase/lipase family. This is a glycoprotein with the molecular weight from 68 kDa to 90 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BCHE antibody 23854-1-AP | Download protocol |
| IHC protocol for BCHE antibody 23854-1-AP | Download protocol |
| WB protocol for BCHE antibody 23854-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Biomed Eng Genome-edited skin epidermal stem cells protect mice from cocaine-seeking behaviour and cocaine overdose. | ||
Cells Improving the Efficiency of Precise Genome Editing with CRISPR/Cas9 to Generate Goats Overexpressing Human Butyrylcholinesterase | ||
Front Immunol Progressions of the correlation between lipid metabolism and immune infiltration characteristics in gastric cancer and identification of BCHE as a potential biomarker |









