• Featured Product
  • KD/KO Validated

BDNF Polyclonal antibody

BDNF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 25699-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Brain-derived neurotrophic factor, brain derived neurotrophic factor, BDNF precursor form

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse cerebellum tissue, rat brain tissue
Positive IHC detected inmouse cerebellum tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25699-1-AP targets BDNF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, macaque
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22489

Product name: Recombinant human BDNF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 130-179 aa of BC029795

Sequence: SDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ

Predict reactive species
Full Name brain-derived neurotrophic factor
Calculated Molecular Weight 247 aa, 28 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC029795
Gene Symbol BDNF
Gene ID (NCBI) 627
RRIDAB_3669493
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23560
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

1) What is BDNF?

BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.

2) FAQs for BDNF

A) I can detect more than one band in my samples
BDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).

Protocols

Product Specific Protocols
IF protocol for BDNF antibody 25699-1-APDownload protocol
IHC protocol for BDNF antibody 25699-1-APDownload protocol
WB protocol for BDNF antibody 25699-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Mol Ther Nucleic Acids

Exploring the therapeutic potential of sγPNA-141: Pharmacodynamics and mechanistic insights during ischemic stroke recovery

Authors - Sanjeev Kumar Yadav

Phytomedicine

Yindan Xinnaotong Soft Capsule improves post-ischemic stroke recovery by regulating CREB/BDNF-mediated synaptic plasticity and CREB/VEGFA-mediated angiogenesis

Authors - Cuicui Cheng
mouseWB

Sci Signal

Glutamatergic argonaute2 promotes the formation of the neurovascular unit in mice

Authors - Chandan Sona
mouseIHC

J Neurosci

Early BDNF Treatment Ameliorates Cell Loss in the Entorhinal Cortex of APP Transgenic Mice.

Authors - Nagahara Alan H AH
mouseWB

Neuropsychopharmacology

CPEB3-dowregulated Nr3c1 mRNA translation confers resilience to developing posttraumatic stress disorder-like behavior in fear-conditioned mice.

Authors - Wen-Hsin Lu
mouseWB

Cell Mol Life Sci

Furin promotes dendritic morphogenesis and learning and memory in transgenic mice.

Authors - Binglin Zhu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Shazia (Verified Customer) (02-03-2026)

Used it for IF in mouse brain tissue and it nicely worked giving you minimum background with optimum results.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: Mouse brain
FH

Samantha (Verified Customer) (10-02-2025)

My lab frequently orders antibodies from Proteintech because of the quality and the speed with which they are delivered. This time was no different! This antibody worked extremely well.

  • Applications: Western Blot
FH

Armelle (Verified Customer) (09-03-2019)

This antibody worked very well. We were able to quantify expression levels in our area of interest.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: bain slice fom the ventrolateral hypothalamus
BDNF Antibody Immunofluorescence, validation (1/500 dilution) in bain slice fom the ventrolateral hypothalamus (Cat no:25699-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...