×
Use Able AI chat for product recommendations

BPNT1 Polyclonal antibody

BPNT1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16461-1-AP
Publications (2)
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

3'(2'),5'-bisphosphate nucleotidase 1, 3'-phosphoadenosine 5'-phosphate phosphatase, Bisphosphate 3 nucleotidase 1, Bisphosphate 3'-nucleotidase 1, BPntase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of HEK-293 cells using BPNT1 Polyclonal antibody (16461-1-AP)

    WB analysis of HEK-293 using 16461-1-AP

    HEK-293 and Hela cells were subjected to SDS PAGE followed by western blot with 16461-1-AP (BPNT1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HeLa cells using BPNT1 Polyclonal antibody (16461-1-AP)

    WB analysis of HeLa using 16461-1-AP

    HeLa cells were subjected to SDS PAGE followed by western blot with 16461-1-AP (BPNT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of human kidney tissue using BPNT1 Polyclonal antibody (16461-1-AP)

    WB analysis of human kidney using 16461-1-AP

    human kidney tissue were subjected to SDS PAGE followed by western blot with 16461-1-AP (BPNT1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HEK-293 cells using BPNT1 Polyclonal antibody (16461-1-AP)

    WB analysis of HEK-293 using 16461-1-AP

    HEK-293 cells were subjected to SDS PAGE followed by western blot with 16461-1-AP (BPNT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human liver tissue using BPNT1 Polyclonal antibody (16461-1-AP)

    IHC staining of human liver using 16461-1-AP

    Immunohistochemical analysis of paraffin-embedded human liver using 16461-1-AP (BPNT1 antibody) at dilution of 1:100 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human liver tissue using BPNT1 Polyclonal antibody (16461-1-AP)

    IHC staining of human liver using 16461-1-AP

    Immunohistochemical analysis of paraffin-embedded human liver using 16461-1-AP (BPNT1 antibody) at dilution of 1:100 (under 40x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using BPNT1 Polyclonal antibody (16461-1-AP)

    IF Staining of HeLa using 16461-1-AP

    Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 16461-1-AP (BPNT1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for BPNT1 in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, human kidney tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16461-1-AP targets BPNT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9523

Product name: Recombinant human BPNT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-325 aa of BC017801

Sequence: MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGVGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVSHRTWPKPDFFRAQFFLESHSCFSRNFKNVSTPIKNIYDVIIYAYETDL

Predict reactive species
Full Name 3'(2'), 5'-bisphosphate nucleotidase 1
Calculated Molecular Weight 325 aa, 36 kDa
Observed Molecular Weight 36-40 kDa
GenBank Accession NumberBC017801
Gene Symbol BPNT1
Gene ID (NCBI) 10380
RRIDAB_2067193
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95861
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for BPNT1 antibody 16461-1-APDownload protocol
IHC protocol for BPNT1 antibody 16461-1-APDownload protocol
WB protocol for BPNT1 antibody 16461-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BPNT1 Polyclonal antibody (Cat# 16461-1-AP) has 2 total citations. These appear in Nature Communications and PLoS One. The cited research covers tRNA acetylation and translation efficiency in mammalian systems, as well as proteomic analysis of rat colonic mucosa in the context of acupuncture treatment for irritable bowel syndrome. Both citations used the antibody for Western blot applications.

Automatically generated from the 2 publication citations by Able AI.
SpeciesApplicationTitle
mouseWB

Nat Commun

Mammalian tRNA acetylation determines translation efficiency and tRNA quality control.

Authors - Na Liu
View Article
ratWB

PLoS One

Proteomic analysis of rat colonic mucosa following acupuncture treatment for irritable bowel syndrome with diarrhea

Authors - Jing Liu
View Article
||
New chat

Able™

正在加载，请稍候...