BTNL8 Polyclonal antibody

BTNL8 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24959-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

butyrophilin like 8, Butyrophilin like protein 8, Butyrophilin-like protein 8, UNQ702/PRO1347

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of MCF-7 using 24959-1-AP
MCF-7 cells were subjected to SDS PAGE followed by western blot with 24959-1-AP (BTNL8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 24959-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 24959-1-AP (BTNL8 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	MCF-7 cells
Positive IHC detected in	human stomach cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24959-1-AP targets BTNL8 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21203 Product name: Recombinant human BTNL8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 90-147 aa of BC119696 Sequence: CSMRHAHLSREVESRVQIGDTFFKPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQW Predict reactive species
Full Name	butyrophilin-like 8
Calculated Molecular Weight	500 aa, 57 kDa
Observed Molecular Weight	50 kDa
GenBank Accession Number	BC119696
Gene Symbol	BTNL8
Gene ID (NCBI)	79908
RRID	AB_2879822
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q6UX41
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BTNL8 (butyrophilin-like 8) belongs to the butyrophilin (BTN) family, a group of immunoglobulin superfamily members structurally and functionally related to the B7 family of immune costimulatory molecules. The protein is predicted to localize to the plasma membrane and is involved in T cell receptor signaling and regulation of cytokine production. It is highly expressed in the gastrointestinal tract, particularly in the duodenum and small intestine, as well as in the colon and rectum.BTNL8 is also expressed in neutrophils. Functionally, BTNL8 plays a role in modulating immune responses. It can augment antigen-induced activation of T lymphocytes, promoting T-cell proliferation and cytokine production.(PMID:24036152)