Tested Applications
Positive WB detected in | HEK-293T cells, MCF-7 cells, C6 cells |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
Product Information
27073-1-AP targets BUB3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25608 Product name: Recombinant human BUB3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 205-328 aa of BC005138 Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT Predict reactive species |
Full Name | budding uninhibited by benzimidazoles 3 homolog (yeast) |
Calculated Molecular Weight | 37 kDa |
Observed Molecular Weight | 37-40 kDa |
GenBank Accession Number | BC005138 |
Gene Symbol | BUB3 |
Gene ID (NCBI) | 9184 |
RRID | AB_2880743 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43684 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BUB3 antibody 27073-1-AP | Download protocol |
IHC protocol for BUB3 antibody 27073-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun DNA replication initiation factor RECQ4 possesses a role in antagonizing DNA replication initiation | ||
J Oncol CDCA3 Predicts Poor Prognosis and Affects CD8+ T Cell Infiltration in Renal Cell Carcinoma | ||
J Biomed Sci BUB1B monoallelic germline variants contribute to prostate cancer predisposition by triggering chromosomal instability |