Tested Applications
Positive WB detected in | mouse testis tissue, HepG2 cells, rat testis tissue |
Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
20414-1-AP targets C11orf67 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14258 Product name: Recombinant human C11orf67 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC002752 Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC Predict reactive species |
Full Name | chromosome 11 open reading frame 67 |
Calculated Molecular Weight | 122 aa, 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC002752 |
Gene Symbol | C11orf67 |
Gene ID (NCBI) | 28971 |
RRID | AB_10694438 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H7C9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C11orf67 is predicted to be involved in positive regulation of fat cell differentiation.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for C11orf67 antibody 20414-1-AP | Download protocol |
IHC protocol for C11orf67 antibody 20414-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |