Tested Applications
Positive IHC detected in | human testis tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25177-1-AP targets C12orf54 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15026 Product name: Recombinant human C12orf54 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC031670 Sequence: MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCSMTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQSAYYPGP Predict reactive species |
Full Name | chromosome 12 open reading frame 54 |
Calculated Molecular Weight | 127 aa, 14 kDa |
GenBank Accession Number | BC031670 |
Gene Symbol | C12orf54 |
Gene ID (NCBI) | 121273 |
RRID | AB_2879943 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6X4T0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for C12orf54 antibody 25177-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |