Tested Applications
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24646-1-AP targets C12orf65 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19965 Product name: Recombinant human C12orf65 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 11-94 aa of BC062329 Sequence: TPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVK Predict reactive species |
Full Name | chromosome 12 open reading frame 65 |
Calculated Molecular Weight | 166 aa, 19 kDa |
GenBank Accession Number | BC062329 |
Gene Symbol | C12orf65 |
Gene ID (NCBI) | 91574 |
RRID | AB_2879653 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H3J6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C12orf65 participates in the process of mitochondrial translation and has been shown to be associated with a spectrum of phenotypes, including early onset optic atrophy, progressive encephalomyopathy, peripheral neuropathy, and spastic paraparesis.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for C12orf65 antibody 24646-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |