Tested Applications
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MDCK cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25583-1-AP targets C13orf30 in IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples.
Tested Reactivity | human, canine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22353 Product name: Recombinant human C13orf30 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-139 aa of BC093659 Sequence: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN Predict reactive species |
Full Name | chromosome 13 open reading frame 30 |
Calculated Molecular Weight | 139 aa, 16 kDa |
GenBank Accession Number | BC093659 |
Gene Symbol | C13orf30 |
Gene ID (NCBI) | 144809 |
RRID | AB_2880139 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8N7L0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for C13orf30 antibody 25583-1-AP | Download protocol |
IF protocol for C13orf30 antibody 25583-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |