Tested Applications
| Positive WB detected in | HeLa cells, PC-3 cells, MDA-MB-453s cells |
| Positive IHC detected in | human ovary cancer tissue, human kidney tissue, human stomach cancer tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
26006-1-AP targets SLIRP in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22945 Product name: Recombinant human C14orf156 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC017895 Sequence: MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF Predict reactive species |
| Full Name | chromosome 14 open reading frame 156 |
| Calculated Molecular Weight | 109 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC017895 |
| Gene Symbol | SLIRP |
| Gene ID (NCBI) | 81892 |
| RRID | AB_2880332 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9GZT3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLIRP, also named as C14orf156, DC23, DC50 and PD04872. It is an RNA-binding protein on steroid receptor RNA activator (SRA), and its expression is ubiquitous in human normal tissues. SLIRP can affect mitochondrial mRNA transcription and energy conversion. In addition, the loss or weakening of SLIRP destroys part of the structure of mitochondria, affects mitochondria energy metabolism, and increases sperm or cell oxidative stress damage (PMID: 33150185). SLIRP has 2 isoforms with the molecular mass of 12 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLIRP antibody 26006-1-AP | Download protocol |
| IHC protocol for SLIRP antibody 26006-1-AP | Download protocol |
| WB protocol for SLIRP antibody 26006-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Redox Biol LRPPRC regulates redox homeostasis via the circANKHD1/FOXM1 axis to enhance bladder urothelial carcinoma tumorigenesis.
| ||
Int J Mol Sci Mitochondrial Protein SLIRP Affects Biosynthesis of Cytochrome c Oxidase Subunits in HEK293T Cells | ||
Cell Death Differ C-IGF1R encoded by cIGF1R acts as a molecular switch to restrict mitophagy of drug-tolerant persister tumour cells in non-small cell lung cancer | ||
J Transl Med A traditional gynecological medicine inhibits ovarian cancer progression and eliminates cancer stem cells via the LRPPRC-OXPHOS axis |























