• Featured Product
  • KD/KO Validated

C14orf166 Polyclonal antibody

C14orf166 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 19848-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

RTRAF, CLE7 homolog, CLE7, CLE, CGI-99

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, mouse pancreas tissue, mouse lung tissue, Jurkat cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman breast cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19848-1-AP targets C14orf166 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13900

Product name: Recombinant human CLE; C14orf166 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-244 aa of BC001722

Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

Predict reactive species
Full Name chromosome 14 open reading frame 166
Calculated Molecular Weight 244 aa, 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC001722
Gene Symbol C14orf166
Gene ID (NCBI) 51637
RRIDAB_10646485
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y224
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human CLE/C14orf166 protein is a positive modulator of cellular RNA polymerase. CLE is also shown to interact with the influenza virus polymerase complex and colocalizes with viral ribonucleoproteins, and is required for viral replication. Similarly, CLE is identified as a novel host interacting partners of the mature hepatitis C virus core protein. CLE levels were significantly higher in the serum of patients with PaCa compared with the control group was strongly expressed in tumor cells, suggesting that C14orf166 may be a potential biomarker of pancreatic adenocarcinoma.

Protocols

Product Specific Protocols
WB protocol for C14orf166 antibody 19848-1-APDownload protocol
IHC protocol for C14orf166 antibody 19848-1-APDownload protocol
IF protocol for C14orf166 antibody 19848-1-APDownload protocol
IP protocol for C14orf166 antibody 19848-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB,IF

Adv Sci (Weinh)

Primate-Specific DAZ Regulates Translation of Cell Proliferation-Related mRNAs and is Essential for Maintenance of Spermatogonia

Authors - Ningjing Ou
mouseWB

Nucleic Acids Res

A novel all-in-one conditional knockout system uncovered an essential role of DDX1 in ribosomal RNA processing.

Authors - Teruhiko Suzuki
humanWB,IHC

Biosci Rep

Overexpressed C14orf166 associates with disease progression and poor prognosis in non-small cell lung cancer.

Authors - Yan-Wu Zhou
humanWB,IHC

J Transl Med

C14orf166 overexpression correlates with tumor progression and poor prognosis of breast cancer.

Authors - Tuck-Yun Cheang
  • KD Validated
humanWB, IHC

Tumour Biol

C14ORF166 overexpression is associated with pelvic lymph node metastasis and poor prognosis in uterine cervical cancer.

Authors - Weijing Zhang
humanWB, IHC

Tumour Biol

Overexpression of chromosome 14 open reading frame 166 correlates with disease progression and poorer prognosis in human NPC.

Authors - Lin Yang
Loading...
||
New chat Able
正在加载,请稍候...