Filter: AllWBIF/ICC

WB analysis of mouse liver using 20801-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse liver using 20801-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of rat liver using 20801-1-AP
rat liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of rat liver using 20801-1-AP
rat liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 20801-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse liver using 20801-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IF Staining of HeLa using 20801-1-AP
Immunofluorescent analysis of HeLa cells using 20801-1-AP (C16orf13 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

C16orf13 Polyclonal antibody

Name: C16orf13 Polyclonal antibody
Brand: Proteintech
SKU: 20801-1-AP

C16orf13 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 20801-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

METTL26, Methyltransferase-like 26, JFP2

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

Positive WB detected in	mouse liver tissue, HeLa cells, rat liver tissue
Positive IF/ICC detected in	HeLa cells

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

20801-1-AP targets C16orf13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14718 Product name: Recombinant human C16orf13 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-107 aa of BC007207 Sequence: MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEWGLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN Predict reactive species
Full Name	chromosome 16 open reading frame 13
Calculated Molecular Weight	204 aa, 23 kDa
Observed Molecular Weight	23 kDa
GenBank Accession Number	BC007207
Gene Symbol	C16orf13
Gene ID (NCBI)	84326
RRID	AB_2878742
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96S19
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.