Filter:
Tested Applications
| Positive WB detected in | PC-3 cells, human kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26086-1-AP targets C16orf61 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23319 Product name: Recombinant human C16orf61 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC032631 Sequence: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK Predict reactive species |
| Full Name | chromosome 16 open reading frame 61 |
| Observed Molecular Weight | 9 kDa |
| GenBank Accession Number | BC032631 |
| Gene Symbol | C16orf61 |
| Gene ID (NCBI) | 56942 |
| RRID | AB_2880369 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRP2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The function of C16orf61 remains largely unknown. It may be involved in cytochrome c oxidase biogenesis. Catalog#26086-1-AP is a rabbit polyclonal antibody raised against the full-length of human C16orf61. The MW of this protein is 9 kDa, and this antibody specially recognises the 9 kDa protein.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for C16orf61 antibody 26086-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
