Tested Applications
| Positive IHC detected in | human colon cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24678-1-AP targets C20orf46 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20385 Product name: Recombinant human C20orf46 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-122 aa of BC156781 Sequence: MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVDYG Predict reactive species |
| Full Name | chromosome 20 open reading frame 46 |
| Calculated Molecular Weight | 256 aa, 28 kDa |
| GenBank Accession Number | BC156781 |
| Gene Symbol | C20orf46 |
| Gene ID (NCBI) | 55321 |
| RRID | AB_2879669 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NUR3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C20orf46, also named as TMEM74B, belongs to the TMEM74 family.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for C20orf46 antibody 24678-1-AP | Download protocol |
| IHC protocol for C20orf46 antibody 24678-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











