C3/C3b/C3c Monoclonal antibody

C3/C3b/C3c Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66157-1-Ig
Clone No.2A6B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

C3, C3/C3a, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, ASP, ARMD9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, human blood, human plasma, HepG2 cells, J774A.1 cells, RAW 264.7 cells
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66157-1-Ig targets C3/C3b/C3c in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15955

Product name: Recombinant human C3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1314-1663 aa of BC150179

Sequence: ESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN

Predict reactive species
Full Name complement component 3
Calculated Molecular Weight 1663 aa, 187 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC150179
Gene Symbol C3
Gene ID (NCBI) 718
RRIDAB_2881553
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01024
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). The third component of complement, C3, plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways (PMID: 11414361). Human C3, composed of α and β chains (115 and 75 kDa, respectively), is cleaved into C3a and C3b by C3 convertase. C3b is further cleaved into iC3b, C3c, C3dg and C3f. This antibody raised against 1314-1663 aa of human C3 protein recognizes the C3 alpha chain, C3b alpha' chain, and C3c alpha' chain fragment 2.

Protocols

Product Specific Protocols
IF protocol for C3/C3b/C3c antibody 66157-1-IgDownload protocol
IHC protocol for C3/C3b/C3c antibody 66157-1-IgDownload protocol
WB protocol for C3/C3b/C3c antibody 66157-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB,IF

J Neuroinflammation

Apelin alleviated neuroinflammation and promoted endogenous neural stem cell proliferation and differentiation after spinal cord injury in rats.

Authors - Qing Liu
IF

Clin Kidney J

Complement abnormality predisposes to the development of malignant hypertension-associated thrombotic microangiopathy disease

Authors - Rong Lian
mouseIF

Int J Oral Sci

Fibroblast derived C3 promotes the progression of experimental periodontitis through macrophage M1 polarization and osteoclast differentiation

Authors - Feilong Ren
mouseIF

Int J Oral Sci

Author Correction: Fibroblast derived C3 promotes the progression of experimental periodontitis through macrophage M1 polarization and osteoclast differentiation

Authors - Feilong Ren
ratWB

Neurochem Int

Quantitative iTRAQ-based proteomic analysis of piperine protected cerebral ischemia/reperfusion injury in rat brain.

Authors - Yichun Zou
mouseWB,ELISA

Virulence

HylS', a fragment of truncated hyaluronidase of Streptococcus suis, contributes to immune evasion by interaction with host complement factor C3b

Authors - Jiajia Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marion (Verified Customer) (08-01-2024)

LPS induction model Fixative: Paraformaldehyde 4% Permeabilization: 10 min; RT; 0.2% Triton X-100 Blocking: 2 h; RT; 10% Normal donkey serum; 1% BSA Primary antibody: 1 night; 4°C Secondary antibody: ab150112 (Abcam); 1h30; RT Antibodies diluted in blocking solution

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: Rat Kidney
C3/C3b/C3c Antibody Immunofluorescence validation (1/200 dilution) in Rat Kidney (Cat no:66157-1-Ig)
FH

Neil (Verified Customer) (05-10-2019)

The Western Blot came out spectacularly! I saw the bands I expected to see, and everything was clear and distinct. I would recommend this to anyone looking to identify C3.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: Synovial Fluid
Loading...
||
New chat

Able

正在加载,请稍候...