Featured Product
KD/KO Validated

C9orf72 Polyclonal antibody

C9orf72 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22637-1-AP

Publications(38)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

C9RANT, DENND9, DENNL72, Guanine nucleotide exchange factor C9orf72

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis of rat brain using 22637-1-AP
rat brain tissue were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 22637-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 22637-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 22637-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 22637-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of transfected cells using 22637-1-AP
WB result of anti-C9ORF72 (22637-1-AP) with Variant1 and 2 transfected. (by Dr. Sarah Mueller).
WB analysis of SH-SY5Y using 22637-1-AP
SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Sp2/0 using 22637-1-AP
Sp2/0 cells were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse testis using 22637-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 22637-1-AP (C9orf72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of SH-SY5Y using 22637-1-AP
IP result of anti-C9orf72 (IP:22637-1-AP, 3ug; Detection:22637-1-AP 1:300) with SH-SY5Y cells lysate 2000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 22637-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 22637-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 22637-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 22637-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 22637-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 22637-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 22637-1-AP (C9orf72 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 22637-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 22637-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 22637-1-AP (C9orf72 antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of SH-SY5Y using 22637-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using C9orf72 antibody (22637-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (38)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	C2C12 cells, HeLa cells, mouse testis tissue, rat brain tissue, SH-SY5Y cells, Sp2/0 cells, transfected cells, HEK-293 cells, NIH/3T3 cells, 3T3-L1 cells
Positive IP detected in	SH-SY5Y cells
Positive IHC detected in	human gliomas tissue, human testis tissue, mouse brain tissue, rat brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	SH-SY5Y cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22637-1-AP targets C9orf72 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, caenorhabditis elegans
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18326 Product name: Recombinant human C9orf72 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC020851 Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG Predict reactive species
Full Name	chromosome 9 open reading frame 72
Calculated Molecular Weight	481 aa, 54 kDa
Observed Molecular Weight	50-54 kDa
GenBank Accession Number	BC020851
Gene Symbol	C9orf72
Gene ID (NCBI)	203228
RRID	AB_10953528
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96LT7
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. It has been reported that C9orf72 forms a complex with Cofilin and other actin binding proteins and 22637-1-AP antibody detects the complex bands around 43 and 68-72 kDa in SDS-PAGE.(PMID: 27723745)

Protocols

Product Specific Protocols
IF protocol for C9orf72 antibody 22637-1-AP	Download protocol
IHC protocol for C9orf72 antibody 22637-1-AP	Download protocol
IP protocol for C9orf72 antibody 22637-1-AP	Download protocol
WB protocol for C9orf72 antibody 22637-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
mouse	WB	Science C9orf72 is required for proper macrophage and microglial function in mice. Authors - J G O'Rourke KO Validated View Article
human	wb	Nat Med Haploinsufficiency leads to neurodegeneration in C9ORF72 ALS/FTD human induced motor neurons. Authors - Yingxiao Shi View Article
mouse,human	WB,CoIP	Cell Metab C9orf72 regulates energy homeostasis by stabilizing mitochondrial complex I assembly. Authors - Tao Wang KO Validated View Article
mouse,human	WB	Nat Neurosci Reduced C9ORF72 function exacerbates gain of toxicity from ALS/FTD-causing repeat expansion in C9orf72. Authors - Qiang Zhu KO Validated View Article
human	WB	Nat Commun C9orf72-catalyzed GTP loading of Rab39A enables HOPS-mediated membrane tethering and fusion in mammalian autophagy Authors - Shen Zhang KO Validated View Article
mouse	WB	Sci Transl Med Loss-of-function mutations in the C9ORF72 mouse ortholog cause fatal autoimmune disease. Authors - Aaron Burberry KO Validated View Article