Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CAMKK2 Polyclonal antibody

CAMKK2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11549-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (5)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Calcium/calmodulin-dependent protein kinase kinase 2, Calcium/calmodulin-dependent protein kinase kinase beta, CaM kinase kinase 2, CaM kinase kinase beta, CaM KK 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, fetal human brain tissue, HeLa cells, PC-3 cells, RAW 264.7 cells
Positive IP detected inPC-3 cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11549-1-AP targets CAMKK2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, monkey, bovine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2093

Product name: Recombinant human CAMKK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-353 aa of BC026060

Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAF

Predict reactive species
Full Name calcium/calmodulin-dependent protein kinase kinase 2, beta
Calculated Molecular Weight 588 aa, 60 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC026060
Gene Symbol CAMKK2
Gene ID (NCBI) 10645
RRIDAB_2259441
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96RR4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CAMKK2(calcium/calmodulin-dependent protein kinase kinase 2) is also named as CAMKKB, KIAA0787 and belongs to the protein kinase superfamily. It regulates hypothalamic production of the orexigenic hormone NPY and contributes to the regulation of energy balance. CAMKK2 in vivo reduces tumor growth suggests that reactivation of CAMKK2 by development of new drugs may be a new strategy to prolong the period to respond androgen-deprivation therapy(ADT)(PMID:22549914). It can be autophosphorylated(PMID:19369195). It has 7 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for CAMKK2 antibody 11549-1-APDownload protocol
IHC protocol for CAMKK2 antibody 11549-1-APDownload protocol
IP protocol for CAMKK2 antibody 11549-1-APDownload protocol
WB protocol for CAMKK2 antibody 11549-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Cell Res

Mannose antagonizes GSDME-mediated pyroptosis through AMPK activated by metabolite GlcNAc-6P

Authors - Yuan-Li Ai
mouseWB

Nature

Fructose-1,6-bisphosphate and aldolase mediate glucose sensing by AMPK.

Authors - Chen-Song Zhang
humanWB

Cancer Discov

Macropinocytosis in Cancer-Associated Fibroblasts Is Dependent on CaMKK2/ARHGEF2 Signaling and Functions to Support Tumor and Stromal Cell Fitness.

Authors - Yijuan Zhang
  • KD Validated
humanWB

Cell Metab

CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.

Authors - Qidong Li
  • KD Validated
humanWB

Nat Commun

Cardiomyocyte OTUD1 drives diabetic cardiomyopathy via directly deubiquitinating AMPKα2 and inducing mitochondrial dysfunction

Authors - Xue Han
humanWB

Nat Commun

Cordycepin prevents radiation ulcer by inhibiting cell senescence via NRF2 and AMPK in rodents.

Authors - Ziwen Wang

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Gaurav (Verified Customer) (02-27-2026)

Works with tissue samples

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Mouse

JIN-FENG (Verified Customer) (10-01-2025)

The CAMKK2 antibody performed well in my experiment. Although it showed some non-specific signals, they didn’t significantly interfere with detection of my target

  • Applications: Western Blot, Cell culture
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293 cell line
CAMKK2 Antibody Western Blot,Cell culture validation (1:1000 dilution) in HEK293 cell line (Cat no:11549-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...