Filter:
Tested Applications
| Positive WB detected in | SH-SY5Y cells, human adrenal gland tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13212-1-AP targets CARTPT in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4004 Product name: Recombinant human CARTPT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-116 aa of BC029882 Sequence: AQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Predict reactive species |
| Full Name | CART prepropeptide |
| Calculated Molecular Weight | 116 aa, 13 kDa |
| Observed Molecular Weight | 4-14 kDa |
| GenBank Accession Number | BC029882 |
| Gene Symbol | CARTPT |
| Gene ID (NCBI) | 9607 |
| RRID | AB_10666161 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16568 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CARTPT antibody 13212-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
