Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Caspase 1/P20 Polyclonal antibody

Caspase 1/P20 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22915-1-AP
Publications(1389)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (7)

Applications

WB, IHC, IF/ICC, IP, ELISA, Cell treatment, Western Blot

CASP1, Caspase1, CASP 1, CASP-1, Caspase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, HepG2 cells, THP-1 cells, U-937 cells
Positive IHC detected inhuman spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected in/ HUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22915-1-AP targets Caspase 1/P20 as part of a matched antibody pair:

MP90002-1: 22915-1-AP capture and 60313-1-Ig detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Cited Reactivityhuman, pig, canine, monkey, chicken, bovine, hamster, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11143

Product name: Recombinant human Caspase 1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-311 aa of BC062327

Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Predict reactive species
Full Name caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
Calculated Molecular Weight 404 aa, 45 kDa
Observed Molecular Weight 45-47 kDa, 30 kDa, 35 kDa
GenBank Accession NumberBC062327
Gene Symbol Caspase 1
Gene ID (NCBI) 834
RRIDAB_2876874
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP29466
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 22915-1-AP can recognize p45 procaspase and the mature fragment p20.

Protocols

Product Specific Protocols
IHC protocol for Caspase 1/P20 antibody 22915-1-APDownload protocol
WB protocol for Caspase 1/P20 antibody 22915-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Cell Res

Signal-induced NLRP3 phase separation initiates inflammasome activation

Authors - Gonglu Zou
WB

Mol Cancer

Metal-enriched HSP90 nanoinhibitor overcomes heat resistance in hyperthermic intraperitoneal chemotherapy used for peritoneal metastases

Authors - Qiang Wang
humanWB

ACS Nano

Engineering Extracellular Vesicles Restore the Impaired Cellular Uptake and Attenuate Intervertebral Disc Degeneration.

Authors - Zhiwei Liao
WB,IF

Mol Cell

Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation

Authors - Chuanlong Wang
IHC

J Hazard Mater

Perinatal exposure to PBEB aggravates liver injury via macrophage-derived TWEAK in male adult offspring mice under western diet

Authors - Wanyue Wang
humanWB

J Hazard Mater

Adverse outcome pathway-based approach to reveal the mechanisms of skin sensitization and long-term aging effects of chlorothalonil

Authors - Yung-Hsuan Cheng

Reviews

    4.7 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Anne (Verified Customer) (04-01-2025)

It worked well in the Western Blot experiment.

  • Applications: Western Blot

Anne (Verified Customer) (01-31-2025)

It worked well in the Western Blot experiment.

  • Applications: Western Blot

Joseph (Verified Customer) (02-19-2020)

This antibody detected pro-caspase 1 and the p20 cleaved product in PDAC cell lines. I did not look for the p10 cleaved product.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: PDAC cell lines

Tanusree (Verified Customer) (12-03-2019)

This antibody works good in western blotting analysis using mouse tissues.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
Loading...
||
New chat

Able

正在加载,请稍候...