Filter: AllWBIPIHCIF-P

WB analysis using 16646-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16646-1-AP (CD163 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IP experiment of human placenta using 16646-1-AP
IP result of anti-CD163 (IP:16646-1-AP, 4ug; Detection:16646-1-AP 1:2000 and HRP-conjugated Mouse Anti-Heavy Chain of Rabbit lgG SA00001-7H) with human placenta tissue lysate 1160 ug.
IHC staining of human placenta using 16646-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human placenta using 16646-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human tonsillitis using 16646-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human tonsillitis using 16646-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 16646-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 16646-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung using 16646-1-AP
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung using 16646-1-AP
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of human tonsillitis using 16646-1-AP
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of human tonsillitis using 16646-1-AP
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of human liver using 16646-1-AP
Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of human liver using 16646-1-AP
Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of human placenta using 16646-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Featured Product
KD/KO Validated

CD163 Polyclonal antibody

CD163 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 16646-1-AP

Publications(231)

Reviews (5)

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (2)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

CD163 molecule, Hemoglobin scavenger receptor, M130, MM130, Scavenger receptor cysteine-rich type 1 protein M130

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (231)
Protocols
Reviews (5)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	human placenta tissue, pig spleen tissue
Positive IP detected in	human placenta tissue
Positive IHC detected in	human placenta tissue, human liver tissue, human lung tissue, human tonsillitis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human tonsillitis tissue, human liver tissue, human placenta tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 47 publications below
IHC	See 90 publications below
IF	See 115 publications below

Product Information

16646-1-AP targets CD163 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity	human, pig
Cited Reactivity	human, mouse, rat, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag10029 Product name: Recombinant human CD163 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 46-401 aa of BC051281 Sequence: GTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRG Predict reactive species
Full Name	CD163 molecule
Calculated Molecular Weight	1156 aa, 125 kDa
Observed Molecular Weight	130-150 kDa
GenBank Accession Number	BC051281
Gene Symbol	CD163
Gene ID (NCBI)	9332
ENSEMBL Gene ID	ENSG00000177575
RRID	AB_2756528
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q86VB7
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD163 is a transmembrane protein which belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. This protein is a scavenger receptor for the hemoglobin-haptoglobin complex and is a marker for monocytes and macrophages. Soluble CD163 (sCD163), as a result of ectodomain shedding during inflammatory activation of macrophages, circulates in blood and has been suggested as a plasma/serum marker for macrophage activity.

Protocols

Product Specific Protocols
IF protocol for CD163 antibody 16646-1-AP	Download protocol
IHC protocol for CD163 antibody 16646-1-AP	Download protocol
IP protocol for CD163 antibody 16646-1-AP	Download protocol
WB protocol for CD163 antibody 16646-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
mouse	IF	Mil Med Res Caveolin-1 is critical for hepatic iron storage capacity in the development of nonalcoholic fatty liver disease Authors - Guang-Hui Deng View Article
mouse,human	IF	Nat Aging Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer Authors - Yifei Cheng View Article
human	IF	J Clin Invest CAP2 promotes gastric cancer metastasis by mediating the interaction between tumor cells and tumor-associated macrophages Authors - Guohao Zhang View Article
mouse	WB	Adv Sci (Weinh) Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis Authors - Bin Liu View Article
human	IHC	Cell Rep Med Targeting neoadjuvant chemotherapy-induced metabolic reprogramming in pancreatic cancer promotes anti-tumor immunity and chemo-response Authors - Rong Tang View Article
human	IF	Nat Commun Single-cell analysis of human glioma and immune cells identifies S100A4 as an immunotherapy target. Authors - Nourhan Abdelfattah View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH Brittney (Verified Customer) (10-09-2025)	Antibody nicely stained M2 macrophage cells. Applications: Immunohistochemistry, Immunofluorescence Primary Antibody Dilution: 1:1000 Cell Tissue Type: Tumor
FH Jaouhara (Verified Customer) (12-05-2023)	Works very well in immunohistochemistry (human cartilage) Applications: Immunohistochemistry Cell Tissue Type: Cartilage
FH Kenzo (Verified Customer) (08-29-2023)	Works well by IF on frozen mouse liver tissue sections. Applications: Immunofluorescence Primary Antibody Dilution: 1:500 Cell Tissue Type: Liver
FH Yasuyo (Verified Customer) (05-27-2022)	Works pretty good. Applications: Immunofluorescence Primary Antibody Dilution: 1:250 Cell Tissue Type: Gastric Cancer CD163 Antibody Immunofluorescence validation (1:250 dilution) in Gastric Cancer (Cat no:16646-1-AP)
FH Emma (Verified Customer) (11-29-2021)	Works well by IF on FFPE tissue @ 1:100 with a Tris-EDTA antigen retrieval. Applications: Immunofluorescence Primary Antibody Dilution: 1:100 Cell Tissue Type: Prostate CD163 Antibody Immunofluorescence validation (1:100 dilution) in Prostate (Cat no:16646-1-AP)