Use Able AI chat for product recommendations

CD68 Polyclonal antibody

CD68 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 25747-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF-P, ELISA

CD68 molecule, GP110, Macrosialin, SCARD1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, U-937 cells
Positive IHC detected inhuman liver tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon tissue, human tonsillitis tissue, human appendicitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25747-1-AP targets CD68 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, canine, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22815

Product name: Recombinant human CD68 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 29-319 aa of BC015557

Sequence: SATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

Predict reactive species
Full Name CD68 molecule
Calculated Molecular Weight 37 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC015557
Gene Symbol CD68
Gene ID (NCBI) 968
RRIDAB_2721140
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP34810
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages. The apparent molecular weight of CD68 is larger than calculated molecular weight due to post-translation modification.

Protocols

Product Specific Protocols
IF protocol for CD68 antibody 25747-1-APDownload protocol
IHC protocol for CD68 antibody 25747-1-APDownload protocol
WB protocol for CD68 antibody 25747-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Cell Metab

Dual impacts of serine/glycine-free diet in enhancing antitumor immunity and promoting evasion via PD-L1 lactylation

Authors - Huan Tong

Cell Metab

Pharmacological inhibition of arachidonate 12-lipoxygenase ameliorates myocardial ischemia-reperfusion injury in multiple species.

Authors - Xiao-Jing Zhang
humanIF

Theranostics

Platelets promote CRC by activating the C5a/C5aR1 axis via PSGL-1/JNK/STAT1 signaling in tumor-associated macrophages

Authors - Xueqin Li
IHC

Nat Commun

The ubiquitin ligase ZNRF1 promotes caveolin-1 ubiquitination and degradation to modulate inflammation.

Authors - Chih-Yuan Lee
IF

EBioMedicine

Social stress is lethal in the mdx model of Duchenne muscular dystrophy.

Authors - Maria Razzoli
IF

Aging Cell

Inhibition of DNA methyltransferase aberrations reinstates antioxidant aging suppressors and ameliorates renal aging.

Authors - Qi Gao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Zach (Verified Customer) (09-12-2025)

The antibody works perfectly with liver samples of MASH mice, and pancreas samples of chronic pancreatitis mice.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: pancreas, liver

Emma (Verified Customer) (11-29-2021)

Works well by IF on FFPE tissue with a Tris-EDTA antigen retrieval. Also works by IHC.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Prostate
CD68 Antibody Immunohistochemistry,Immunofluorescence validation (1:200 dilution) in Prostate (Cat no:25747-1-AP)

Fabio Henrique (Verified Customer) (01-17-2019)

Figure 1. IF of CD68 (red) in human spleen. Formalin-fixed paraffin-embedded human spleen tissue was used as positive control to probe for CD68. Heat-induced antigen retrieval was performed in sodium citrate buffer pH 6.0 + Tween20 at 0.5%. Tissue incubated at 96*C for 20 min inside the buffer. Permeabilization was done with washes of TBSTritonX 0.25% for 3x 5min and blocking was done in TBS 10% Goat serum, 1% BSA, for 1 hr at RT. Anti-CD68 was used at 1:200 in blocking buffer, overnight incubation at 4*C. Secondary antibody AlexaFluor 488 was used at 1:500 for 1 hr at RT. Imaged using a Nikon A1 confocal microscope. Figure 2: CD68 (red) and CD206 (green) in human primary macrophages polarized to M2-phenotype, encapsulated in 3D hydrogel (hyaluronic acid and collagen type 1). Staining was performed as described above, except primary (CD68) was used at 1:100 and secondary antibodies were used at 1:500.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100 (hydrogels); 1:200 (2D samples)
  • Cell Tissue Type: Spleen and 3D culture of human primary macrophages
CD68 Antibody Immunofluorescence, validation (1:100 (hydrogels); 1:200 (2D samples) dilution) in Spleen and 3D culture of human primary macrophages (Cat no:25747-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...