CD72 Polyclonal antibody

CD72 Polyclonal Antibody for WB, ELISA
Cat No. 13469-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Lyb-2, LYB2, Lyb 2, CD72b, CD72 molecule

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13469-1-AP targets CD72 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4262

Product name: Recombinant human CD72 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 116-359 aa of BC030227

Sequence: VRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

Predict reactive species
Full Name CD72 molecule
Calculated Molecular Weight 359 aa, 40 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC030227
Gene Symbol CD72
Gene ID (NCBI) 971
RRIDAB_10638306
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21854
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD72 is a type II transmembrane glycoprotein of 39-45 kDa and is expressed as a disulphide-linked homodimer (PMID: 1711157). CD72 is a pan B-cell marker covering the full range of differentiation from the very early stages of B cells to mature surface Ig+ B cells (PMID: 1384316). It is expressed in all stages of B cell development except plasma cells. CD72 is also expressed by dendritic cells, tissue macrophages in the red pulp of the spleen and von Kupffer cells in the liver (PMID: 8561576; 1384316). CD72 is the ligand for CD5 (PMID: 1711157). CD72 is a negative regulator of BCR signaling (PMID: 9590210). Interaction of CD100 with CD72 strictly tunes the strength of BCR signals and is essential for maintaining immunological homeostasis as well as generating a proper immune response (PMID: 16113236).

Protocols

Product Specific Protocols
WB protocol for CD72 antibody 13469-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...