Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, PC-3 cells, HL-60 cells, Jurkat cells, HepG2 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:14000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10252-1-AP targets Cdc20 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0295 Product name: Recombinant human CDC20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC001088 Sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSA Predict reactive species |
| Full Name | cell division cycle 20 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC001088 |
| Gene Symbol | CDC20 |
| Gene ID (NCBI) | 991 |
| RRID | AB_2229016 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12834 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cdc20 (Cell-division cycle protein 20 homologue) is also named as p55CDC and belongs to the WD repeat CDC20/Fizzy family. Cdc20 has important functions in chromosome segregation and mitotic exit. Cdc20 is the target of the spindle assembly checkpoint (SAC) and a key cofactor of the anaphase-promoting complex or cyclosome (APC/CCDC20) E3 ubiquitin ligase, thus regulating APC/C ubiquitin activity on specific substrates for their subsequent degradation by the proteasome (PMID: 28202332). The 55-kDa band corresponded to the size of Cdc20 (PMID: 22566641).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cdc20 antibody 10252-1-AP | Download protocol |
| IHC protocol for Cdc20 antibody 10252-1-AP | Download protocol |
| IP protocol for Cdc20 antibody 10252-1-AP | Download protocol |
| WB protocol for Cdc20 antibody 10252-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-CDC20 antibody (Cat# 10252-1-AP) has 62 citations published across ~48 journals, including high-impact venues such as Nature Medicine, Nature Communications, Molecular Cell, EMBO Journal, Science Advances, and Cell Death & Disease. Research fields span oncology (liver, lung, glioblastoma, prostate, ovarian, pancreatic, bladder, breast, and hematologic cancers), cell cycle regulation, DNA damage response, immunotherapy, fibrosis, and oocyte biology. Applications include WB, IHC, IF, IP, and CoIP in human, mouse, and canine samples.
| Species | Application | Title |
|---|---|---|
Nat Med Translation control of the immune checkpoint in cancer and its therapeutic targeting. | ||
Nat Commun DNA replication initiation factor RECQ4 possesses a role in antagonizing DNA replication initiation | ||
Exp Hematol Oncol Inhibition of CDC20 potentiates anti-tumor immunity through facilitating GSDME-mediated pyroptosis in prostate cancer
| ||
Exp Hematol Oncol p53 directly downregulates the expression of CDC20 to exert anti-tumor activity in mantle cell lymphoma | ||
J Adv Res Transcription factor Meis1 act as a new regulator of ischemic arrhythmias in mice
| ||
Mol Cell Spatiotemporal Proteomic Analysis of Stress Granule Disassembly Using APEX Reveals Regulation by SUMOylation and Links to ALS Pathogenesis. |
