Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells |
Positive IHC detected in | human placenta tissue, human brain tissue, human heart tissue, human liver tissue, human ovary tissue, human skin tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
13060-2-AP targets CDK2AP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3736 Product name: Recombinant human CDK2AP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC034717 Sequence: MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS Predict reactive species |
Full Name | cyclin-dependent kinase 2 associated protein 1 |
Calculated Molecular Weight | 115 aa, 13 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC034717 |
Gene Symbol | CDK2AP1 |
Gene ID (NCBI) | 8099 |
RRID | AB_10340136 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14519 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CDK2AP1 antibody 13060-2-AP | Download protocol |
IHC protocol for CDK2AP1 antibody 13060-2-AP | Download protocol |
IF protocol for CDK2AP1 antibody 13060-2-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |