Tested Applications
Positive WB detected in | mouse brain tissue, human heart tissue |
Positive IP detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
13175-1-AP targets CDS2 in WB, IP, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, zebrafish |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3842 Product name: Recombinant human CDS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 354-445 aa of BC025751 Sequence: GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE Predict reactive species |
Full Name | CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 |
Calculated Molecular Weight | 445 aa, 51 kDa |
Observed Molecular Weight | 51 kDa |
GenBank Accession Number | BC025751 |
Gene Symbol | CDS2 |
Gene ID (NCBI) | 8760 |
RRID | AB_2291458 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95674 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CDS2 antibody 13175-1-AP | Download protocol |
IP protocol for CDS2 antibody 13175-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun AGPAT2 interaction with CDP-diacylglycerol synthases promotes the flux of fatty acids through the CDP-diacylglycerol pathway.
| ||
Nat Commun Anti-angiogenic effects of VEGF stimulation on endothelium deficient in phosphoinositide recycling. | ||
Sci Rep Enzymatic fluorometric assays for quantifying all major phospholipid classes in cells and intracellular organelles. |