KD/KO Validated

CDX1 Polyclonal antibody

CDX1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21655-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Caudal type homeobox 1, Caudal type homeobox protein 1, Caudal-type homeobox protein 1, Homeobox protein CDX 1, Homeobox protein CDX-1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis using 21655-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 21655-1-AP (CDX1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 21655-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 21655-1-AP (CDX1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Caco-2 using 21655-1-AP
WB result of CDX1 antibody (21655-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-CDX1 transfected Caco-2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse small intestine using 21655-1-AP
mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 21655-1-AP (CDX1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse stomach using 21655-1-AP
mouse stomach tissue were subjected to SDS PAGE followed by western blot with 21655-1-AP (CDX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse small intestine using 21655-1-AP
mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 21655-1-AP (CDX1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse small intestine using 21655-1-AP
mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 21655-1-AP (CDX1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of Caco-2 using 21655-1-AP
IP result of anti-CDX1 (IP:21655-1-AP, 4ug; Detection:21655-1-AP 1:1000) with Caco-2 cells lysate 1400 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 21655-1-AP
Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 21655-1-AP (CDX1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse colon using 21655-1-AP
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 21655-1-AP (CDX1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of Caco-2 using 21655-1-AP
Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using CDX1 antibody (21655-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Caco-2 cells, mouse small intestine tissue, mouse stomach tissue, mouse colon tissue, rat colon tissue
Positive IP detected in	Caco-2 cells
Positive IHC detected in	human colon cancer tissue, mouse colon tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	Caco-2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21655-1-AP targets CDX1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16376 Product name: Recombinant human CDX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 105-154 aa of BC096252 Sequence: KQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP Predict reactive species
Full Name	caudal type homeobox 1
Calculated Molecular Weight	265 aa, 28 kDa
Observed Molecular Weight	28-35 kDa
GenBank Accession Number	BC096252
Gene Symbol	CDX1
Gene ID (NCBI)	1044
RRID	AB_2878901
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P47902
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for CDX1 antibody 21655-1-AP	Download protocol
IHC protocol for CDX1 antibody 21655-1-AP	Download protocol
IP protocol for CDX1 antibody 21655-1-AP	Download protocol
WB protocol for CDX1 antibody 21655-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

All (1)

Species	Application	Title
		Cell Biol Int Piwei Peiyuan Pill Ameliorates Chronic Atrophic Gastritis and Intestinal Metaplasia at Least in Part by Inhibiting the Pellino1/IRAK1/NF-κB Signaling Axis. Authors - Cheng Zhang View Article