Featured Product
KD/KO Validated

CEPT1 Polyclonal antibody

CEPT1 Polyclonal Antibody for IHC, ELISA

Cat No. 20496-1-AP

Publications(10)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF, ELISA

Synonyms

1-alkenyl-2-acylglycerol choline phosphotransferase, choline/ethanolamine phosphotransferase 1, EC:2.7.8.1, EC:2.7.8.22, hCEPT1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHC

IHC staining of human liver using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse spleen using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat liver using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat spleen using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cervical cancer using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cervical cancer using 20496-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (10)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in

human liver tissue, human cervical cancer tissue, human pancreas tissue, human tonsillitis tissue, mouse liver tissue, mouse spleen tissue, rat liver tissue, rat spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20496-1-AP targets CEPT1 in IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14140 Product name: Recombinant human CEPT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC032610 Sequence: MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLITII Predict reactive species
Full Name	choline/ethanolamine phosphotransferase 1
Calculated Molecular Weight	416 aa, 47 kDa
GenBank Accession Number	BC032610
Gene Symbol	CEPT1
Gene ID (NCBI)	10390
RRID	AB_10694283
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y6K0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Choline-enthanolamine phosphotransferase 1 (CEPT1) is a 47-kDa membrane-bound protein that catalyzes the terminal step of the Kennedy pathway. CEPT1 is encoded by the Cept1 gene and is responsible for phosphatidylcholine (PC) and phosphatidylethanolamine (PE) production (PMID: 33214136, 30030520).

Protocols

Product Specific Protocols
IHC protocol for CEPT1 antibody 20496-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	IF	Protein Cell Proteomic analysis of ferroptosis pathways reveals a role of CEPT1 in suppressing ferroptosis Authors - Xiaoguang Liu View Article
human		Cell Res DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling. Authors - Pengli Zheng View Article
human	IF	J Lipid Res Diabetes Adversely Affects Phospholipid Profiles in Human Carotid Artery Endarterectomy Plaques. Authors - Mohamed A Zayed View Article
human	IF	J Hazard Mater YTHDC2 mediated RNA m6A modification contributes to PM2.5-induced hepatic steatosis Authors - Zhipeng Yan View Article
human	IF	Hepatol Commun Dysregulation of lipid metabolism in the pseudolobule promotes region-specific autophagy in hepatitis B liver cirrhosis Authors - Wenjun Pu View Article
human	IHC	J Cell Mol Med HIF-1α Promotes the Confined Migration of Gastric Cancer Cells by Modulating Phosphatidylcholine Metabolism. Authors - Ming Zhou View Article