Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17037-1-AP targets CHAF1A in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10536 Product name: Recombinant human CHAF1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 607-956 aa of BC067093 Sequence: EEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS Predict reactive species |
| Full Name | chromatin assembly factor 1, subunit A (p150) |
| Calculated Molecular Weight | 956 aa, 107 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC067093 |
| Gene Symbol | CHAF1A |
| Gene ID (NCBI) | 10036 |
| RRID | AB_2291707 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13111 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chromatin assembly factor 1 (CAF1) is the only histone chaperone known to assemble histones H3 and H4 onto newly synthesized DNA both in vitro and in vivo [PMID:17065558]. The 938 amino acid multidomain p150 (CHAF1A) binds via its C-terminal third to p60, which is an essential step for nucleosome assembly because knocking down either subunit disrupts the activity [PMID:14519857]. In addition, CAF1 facilitates DNA synthesis depending on the binding of the N-terminal 31 residues of p150 to the proliferating cell nuclear antigen (PCNA), which acts as a sliding clamp to stimulate the processivity of DNA polymerase [PMID:10648606]. CHAF1A regulates the formation of heterochromatin in mammalian cells during replication and in plants it maintains the transcription of certain subsets of genes. Furthermore, CHAF1A exists in a chromatin-remodeling complex WINAC, which coactivates ligand-induced transactivation function of the vitamin D receptor [PMID:12837248]. CHAF1A protein exists some phosphorylation sites, which may affect its theoretical molecular weight when tested.And a 150 kDa band was recognized (PMID:27445493).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CHAF1A antibody 17037-1-AP | Download protocol |
| IP protocol for CHAF1A antibody 17037-1-AP | Download protocol |
| WB protocol for CHAF1A antibody 17037-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Nat Struct Mol Biol Reprogramming of the histone H3.3 landscape in the early mouse embryo. | ||
EMBO J Histone chaperone CAF-1 promotes HIV-1 latency by leading the formation of phase-separated suppressive nuclear bodies.
| ||
Cancers (Basel) Human Ccr4 and Caf1 Deadenylases Regulate Proliferation and Tumorigenicity of Human Gastric Cancer Cells via Modulating Cell Cycle Progression.
| ||
J Biol Chem The histone chaperone Spt6 is required for activation-induced cytidine deaminase target determination through H3K4me3 regulation. | ||
J Virol The crosstalk between ubiquitination and GlcNAcylation of CHAF1A regulates HIV-1 latency and reactivation. | ||
Reprod Sci CHAF1A Promotes Preadipocyte Differentiation and Contributes to Macrosomia in Gestational Diabetes Mellitus.
|
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Annabel (Verified Customer) (02-12-2026) | Showed a clear single band in B cell lines, treated with activators. Results were as expected from proteomics experiments.
|
Hasan (Verified Customer) (05-17-2023) | HeLa cells were pre-extracted for 5 mins then fixed with 4% PFA for 15 mins. Blocking with 5% FBS for 40 min and primary antibody incubation overnight.
 |
