• Featured Product
  • KD/KO Validated

CHCHD2 Monoclonal antibody

CHCHD2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66302-1-Ig
Clone No.2G1G10

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

2G1G10, AAG10, Aging-associated gene 10 protein, C7orf17, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, rat liver tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, L02 cells, SMMC-7721 cells, pig liver tissue
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1500-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66302-1-Ig targets CHCHD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24219

Product name: Recombinant human CHCHD2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-151 aa of BC003079

Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA

Predict reactive species
Full Name coiled-coil-helix-coiled-coil-helix domain containing 2
Calculated Molecular Weight 151 aa, 16 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC003079
Gene Symbol CHCHD2
Gene ID (NCBI) 51142
RRIDAB_2881685
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y6H1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).

Protocols

Product Specific Protocols
WB protocol for CHCHD2 antibody 66302-1-IgDownload protocol
IHC protocol for CHCHD2 antibody 66302-1-IgDownload protocol
IF protocol for CHCHD2 antibody 66302-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Proc Natl Acad Sci U S A

A nucleolar long "non-coding" RNA encodes a novel protein that functions in response to stress

Authors - Shuang Feng
humanWB

Proc Natl Acad Sci U S A

Mitochondrial Nuclear Retrograde Regulator 1 (MNRR1) rescues the cellular phenotype of MELAS by inducing homeostatic mechanisms.

Authors - Siddhesh Aras
humanWB,IHC,IF

Acta Neuropathol Commun

Reduced erythrocytic CHCHD2 mRNA is associated with brain pathology of Parkinson's disease.

Authors - Xiaodan Liu
humanWB

Hum Mol Genet

Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS.

Authors - Isabella R Straub
  • KD Validated
WB,IF

Hum Mol Genet

Mouse midbrain dopaminergic neurons survive loss of the PD-associated mitochondrial protein CHCHD2.

Authors - Mai K Nguyen
humanWB

Hum Mol Genet

Loss of CHCHD2 and CHCHD10 activates OMA1 peptidase to disrupt mitochondrial cristae phenocopying patient mutations.

Authors - Yi-Ting Liu
  • KO Validated
Loading...
||
New chat Able
正在加载,请稍候...