Use Able AI chat for product recommendations

CKAP4 Polyclonal antibody

CKAP4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16686-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

63 kDa membrane protein, CLIMP 63, Climp-63, ERGIC 63, p63

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, rat kidney tissue, HeLa cells, HepG2 cells, NIH/3T3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman kidney tissue, human liver tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16686-1-AP targets CKAP4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10019

Product name: Recombinant human CKAP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 254-602 aa of BC082972

Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV

Predict reactive species
Full Name cytoskeleton-associated protein 4
Calculated Molecular Weight 602 aa, 66 kDa
Observed Molecular Weight 63 kDa
GenBank Accession NumberBC082972
Gene Symbol CKAP4
Gene ID (NCBI) 10970
RRIDAB_2276275
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07065
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CKAP4, also named as Climp-63, is a 63 kDa cytoskeleton-linking membrane protein. It is the partner of triadin. CKAP4 is responsible for this association of triads and microtubules. It functions as a key structural component, tethering the ER to the microtubule cytoskeleton and thereby regulating ER network morphology and dynamics. Beyond its structural role, CKAP4 has been identified as a multifunctional signaling receptor present on the plasma membrane for various ligands, including tissue plasminogen activator, anti-proliferative factor, and DICKKOPF1 (DKK1). This dual localization enables CKAP4 to participate in diverse cellular processes such as cell proliferation, migration, and immune modulation. Its dysregulation is implicated in several pathological conditions, including cancers, fibrosis, and inflammatory diseases, highlighting its significance as a potential therapeutic target and biomarker.

Protocols

Product Specific Protocols
IF protocol for CKAP4 antibody 16686-1-APDownload protocol
IHC protocol for CKAP4 antibody 16686-1-APDownload protocol
IP protocol for CKAP4 antibody 16686-1-APDownload protocol
WB protocol for CKAP4 antibody 16686-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Nature

Regulation of endoplasmic reticulum turnover by selective autophagy.

Authors - Aliaksandr Khaminets
ratWB

Cell Metab

Palmitoylation couples insulin hypersecretion with β cell failure in diabetes

Authors - Guifang Dong
humanWB

Nat Cell Biol

Combinatorial selective ER-phagy remodels the ER during neurogenesis

Authors - Melissa J Hoyer
humanWB

Nat Commun

AMFR-mediated Flavivirus NS2A ubiquitination subverts ER-phagy to augment viral pathogenicity

Authors - Linliang Zhang
humanWB,CoIP

Nat Commun

Parvimonas micra promotes oral squamous cell carcinoma metastasis through TmpC-CKAP4 axis

Authors - Houbao Qi
humanWB

Mol Cell

Quality Control of ER Membrane Proteins by the RNF185/Membralin Ubiquitin Ligase Complex

Authors - Michael L van de Weijer

Reviews

    5.0 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sai Sindhura (Verified Customer) (08-19-2026)

Very good antibody CKAP4

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000

Audrey (Verified Customer) (11-12-2025)

Antibody gave good signal with low backgound in brain sections fixed with 4% PFA.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Brain

udesh (Verified Customer) (06-25-2025)

worked well at 1:2000 for MSCs

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: MSCs

WEI (Verified Customer) (06-28-2020)

Single strong band at correct size.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: Mouse Heart
Loading...
||
New chat

Able

正在加载,请稍候...