Use Able AI chat for product recommendations

CLINT1 Polyclonal antibody

CLINT1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

EPN4, Enthoprotin, ENTH, Clint, Clathrin-interacting protein localized in the trans-Golgi region

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CLINT1 in ?

Tested Applications

Positive WB detected inHepG2 cells, HEK-293 cells, HeLa cells, Jurkat cells, mouse brain tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10470-1-AP targets CLINT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0754

Product name: Recombinant human CLINT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 326-625 aa of BC004467

Sequence: LVDLFDGTSQSTGGSADLFGGFADFGSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDPSVNISLDNLLPGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGTMGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK

Predict reactive species
Full Name clathrin interactor 1
Calculated Molecular Weight 68 kDa
Observed Molecular Weight 68 kDa, 80 kDa
GenBank Accession NumberBC004467
Gene Symbol CLINT1
Gene ID (NCBI) 9685
RRIDAB_2276405
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14677
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clathrin interactor 1 (CLINT1), also known as enthoprotin or epsin-4, belongs to the epsin family of endocytic adapter proteins. CLINT1 interacts with clathrin, the adapter protein AP-1 and phosphoinositides. It may have a role in the formation of clathrin coated vesicles and trafficking between the trans-Golgi network and endosomes. Mutations in the gene of CLINT1 are associated with a susceptibility to schizophrenia and psychotic disorders. Calculated molecular weight of CLINT1 is 68 kDa. The migration of endogenous CLINT1 at 80 kDa has also been reported (PMID: 12213833; 15811338).

Protocols

Product Specific Protocols
IF protocol for CLINT1 antibody 10470-1-APDownload protocol
IHC protocol for CLINT1 antibody 10470-1-APDownload protocol
IP protocol for CLINT1 antibody 10470-1-APDownload protocol
WB protocol for CLINT1 antibody 10470-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CLINT1 Polyclonal antibody (Cat# 10470-1-AP) has 3 total citations. These appear in Nature Communications, Cell Reports, and bioRxiv. The associated research fields include ubiquitin E3 ligase substrate identification, cytotoxic T cell signaling in cancer and transplant immunology, and PKA-driven lysosomal vesicle transport during synaptic maintenance.

SpeciesApplicationTitle
humanWB

Nat Commun

BioE3 identifies specific substrates of ubiquitin E3 ligases

Authors - Orhi Barroso-Gomila
humanWB

Cell Rep

DNA-PKcs controls the cytotoxic T cell response to cancer and transplant allograft through regulating LAT-dependent signaling.

Authors - Randall R. Rainwater
WB

bioRxiv

PKA Activity-Driven Modulation of Bidirectional Long-Distance transport of Lysosomal vesicles During Synapse Maintenance

Authors - Kerriann K Badal

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Joleen Cheah, 2019) rated this antibody 4/5 stars for Western Blot at a 1:1000 dilution on MDCK GII samples. The antibody recognized CLINT1 prominently but showed some background and lower-intensity non-specific bands alongside the target. Overall, the review suggests the antibody performs well for detecting CLINT1 by WB, though users may want to account for minor non-specific signals when interpreting results.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Joleen (Verified Customer) (06-16-2019)

Recognizes CLINT1 prominently with some background, non-specific bands that were of lower intensity than CLINT1.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: MDCK GII
CLINT1 Antibody Western Blot, validation (1:1000 dilution) in MDCK GII (Cat no:10470-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...