Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, Jurkat cells, mouse brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10470-1-AP targets CLINT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0754 Product name: Recombinant human CLINT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 326-625 aa of BC004467 Sequence: LVDLFDGTSQSTGGSADLFGGFADFGSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDPSVNISLDNLLPGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGTMGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK Predict reactive species |
| Full Name | clathrin interactor 1 |
| Calculated Molecular Weight | 68 kDa |
| Observed Molecular Weight | 68 kDa, 80 kDa |
| GenBank Accession Number | BC004467 |
| Gene Symbol | CLINT1 |
| Gene ID (NCBI) | 9685 |
| RRID | AB_2276405 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14677 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Clathrin interactor 1 (CLINT1), also known as enthoprotin or epsin-4, belongs to the epsin family of endocytic adapter proteins. CLINT1 interacts with clathrin, the adapter protein AP-1 and phosphoinositides. It may have a role in the formation of clathrin coated vesicles and trafficking between the trans-Golgi network and endosomes. Mutations in the gene of CLINT1 are associated with a susceptibility to schizophrenia and psychotic disorders. Calculated molecular weight of CLINT1 is 68 kDa. The migration of endogenous CLINT1 at 80 kDa has also been reported (PMID: 12213833; 15811338).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CLINT1 antibody 10470-1-AP | Download protocol |
| IHC protocol for CLINT1 antibody 10470-1-AP | Download protocol |
| IP protocol for CLINT1 antibody 10470-1-AP | Download protocol |
| WB protocol for CLINT1 antibody 10470-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CLINT1 Polyclonal antibody (Cat# 10470-1-AP) has 3 total citations. These appear in Nature Communications, Cell Reports, and bioRxiv. The associated research fields include ubiquitin E3 ligase substrate identification, cytotoxic T cell signaling in cancer and transplant immunology, and PKA-driven lysosomal vesicle transport during synaptic maintenance.
| Species | Application | Title |
|---|---|---|
Cell Rep DNA-PKcs controls the cytotoxic T cell response to cancer and transplant allograft through regulating LAT-dependent signaling. | ||
bioRxiv PKA Activity-Driven Modulation of Bidirectional Long-Distance transport of Lysosomal vesicles During Synapse Maintenance |
Reviews
What customers say
One reviewer (Joleen Cheah, 2019) rated this antibody 4/5 stars for Western Blot at a 1:1000 dilution on MDCK GII samples. The antibody recognized CLINT1 prominently but showed some background and lower-intensity non-specific bands alongside the target. Overall, the review suggests the antibody performs well for detecting CLINT1 by WB, though users may want to account for minor non-specific signals when interpreting results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joleen (Verified Customer) (06-16-2019) | Recognizes CLINT1 prominently with some background, non-specific bands that were of lower intensity than CLINT1.
![]() |














