• Featured Product
  • KD/KO Validated

CLTA Polyclonal antibody

CLTA Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10852-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Clathrin light chain A, clathrin, light chain (Lca), LCA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, mouse brain tissue, K-562 cells, Raji cells, C2C12 cells, C6 cells, PC-12 cells
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, HEK-293 cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10852-1-AP targets CLTA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1299

Product name: Recombinant human CLTA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-218 aa of BC019287

Sequence: MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH

Predict reactive species
Full Name clathrin, light chain (Lca)
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 35-38 kDa
GenBank Accession NumberBC019287
Gene Symbol CLTA
Gene ID (NCBI) 1211
RRIDAB_2083025
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09496
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (180 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The light chain subunits are thought to regulate the formation or disassembly of clathrin coats. (PMID: 2445759; 8374173; 3563513)

Protocols

Product Specific Protocols
IF protocol for CLTA antibody 10852-1-APDownload protocol
IHC protocol for CLTA antibody 10852-1-APDownload protocol
IP protocol for CLTA antibody 10852-1-APDownload protocol
WB protocol for CLTA antibody 10852-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Commun

Imaging vesicle formation dynamics supports the flexible model of clathrin-mediated endocytosis.

Authors - Tomasz J Nawara
humanWB

Proc Natl Acad Sci U S A

Clathrin light chains' role in selective endocytosis influences antibody isotype switching.

Authors - Shuang Wu
  • KO Validated
humanWB

J Cell Biol

Alternative splicing of clathrin heavy chain contributes to the switch from coated pits to plaques.

Authors - Gilles Moulay

Small

Persistency of Enlarged Autolysosomes Underscores Nanoparticle-Induced Autophagy in Hepatocytes.

Authors - Ji-Qian Zhang
ratIF

Acta Pharmacol Sin

GPR97 deficiency ameliorates renal interstitial fibrosis in mouse hypertensive nephropathy

Authors - Ji-Chao Wu
ratIHC

J Bone Miner Res

Adaptor protein complex 2-mediated, clathrin-dependent endocytosis, and related gene activities, are a prominent feature during maturation stage amelogenesis.

Authors - Lacruz Rodrigo S RS

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kuldeep (Verified Customer) (07-28-2025)

Used for western blotting. Ab worked well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hippocamus homogenate
CLTA Antibody Western Blot validation (1:1000 dilution) in Hippocamus homogenate (Cat no:10852-1-AP)
FH

Kuldeep (Verified Customer) (07-28-2025)

Used for western blotting. Ab worked well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hippocamus homogenate
CLTA Antibody Western Blot validation (1:1000 dilution) in Hippocamus homogenate (Cat no:10852-1-AP)
FH

Azita (Verified Customer) (06-17-2021)

Immunocytochemistry labelling of (4% PFA) fixed NSC-34 cells by CLTA Polyclonal antibody at dilution of 1:50 showed strong labelling.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: NSC-34 cells
FH

K (Verified Customer) (06-10-2021)

this Ab works well for western blotting in mouse, human and rat cells

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1;1000
FH

Cristian (Verified Customer) (04-17-2019)

Immunofluorescent analysis of (PFA 3%) fixed HeLa cells using 10852-1-AP (CLTA antibody) at dilution of 1:500 and Alexa Fluor 594-conjugated Affinipure Goat Anti-Rabbit IgG (H+L)

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HeLa
CLTA Antibody Immunofluorescence, validation (1:500 dilution) in HeLa (Cat no:10852-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...