Tested Applications
| Positive WB detected in | HepG2 cells, A431 cells, HeLa cells, pig stomach tissue, HT-1080 cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | human breast hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66244-1-Ig targets CNN2 in WB, IHC, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23594 Product name: Recombinant human CNN2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 224-309 aa of BC141818 Sequence: PGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY Predict reactive species |
| Full Name | calponin 2 |
| Calculated Molecular Weight | 309 aa, 34 kDa |
| Observed Molecular Weight | 34-36 kDa |
| GenBank Accession Number | BC141818 |
| Gene Symbol | CNN2 |
| Gene ID (NCBI) | 1265 |
| RRID | AB_2881633 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q99439 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CNN2 antibody 66244-1-Ig | Download protocol |
| WB protocol for CNN2 antibody 66244-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















