Featured Product
KD/KO Validated

CNN3 Polyclonal antibody

CNN3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11509-1-AP

Publications (7)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Calponin 3, Calponin3, Calponin-3, CNN 3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis of HEK-293 using 11509-1-AP
WB result of CNN3 antibody (11509-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CNN3 transfected HEK-293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 11509-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11509-1-AP (CNN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HAP1 cells using 11509-1-AP
HAP1 (WT and CNN3 KO) lysates prepared with RIPA buffer, 20 μg of protein loaded. 11509-1-AP incubated at 1:100 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown for each blot. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
×
HAP1 (WT and CNN3 KO) lysates prepared with RIPA buffer, 20 μg of protein loaded. 11509-1-AP incubated at 1:100 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown for each blot. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
WB analysis of human kidney using 11509-1-AP
human kidney tissue were subjected to SDS PAGE followed by western blot with 11509-1-AP (CNN3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human skeletal muscle using 11509-1-AP
human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11509-1-AP (CNN3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of U-87MG cells using 11509-1-AP
U-87MG lysates prepared and IP of APP performed using 2.0 μg of 11509-1-AP coupled to protein A- Dynabeads beads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitated; HC = antibody heavy chain. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
×
U-87MG lysates prepared and IP of APP performed using 2.0 μg of 11509-1-AP coupled to protein A- Dynabeads beads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitated; HC = antibody heavy chain. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
IP experiment of HEK-293 using 11509-1-AP
IP result of anti-CNN3 (IP:11509-1-AP, 4ug; Detection:11509-1-AP 1:15000) with HEK-293 cells lysate 960 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 11509-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11509-1-AP (CNN3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 11509-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11509-1-AP (CNN3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 11509-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11509-1-AP (CNN3 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin using 11509-1-AP
Immunohistochemical analysis of paraffin-embedded human skin using 11509-1-AP (CNN3 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin using 11509-1-AP
Immunohistochemical analysis of paraffin-embedded human skin using 11509-1-AP (CNN3 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human hysteromyoma using 11509-1-AP
Immunohistochemical analysis of paraffin-embedded human hysteromyoma using 11509-1-AP (CNN3 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human hysteromyoma using 11509-1-AP
Immunohistochemical analysis of paraffin-embedded human hysteromyoma using 11509-1-AP (CNN3 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 11509-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CNN3 antibody (11509-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CNN3 in ?

Overview

Tested Applications
Product Information
Publications (7)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HCT 116 cells, HAP1 cells, human kidney tissue, human skeletal muscle tissue, HEK-293 cells, HepG2 cells, NIH/3T3 cells
Positive IP detected in	HEK-293 cells, U-87MG cells
Positive IHC detected in	human prostate cancer tissue, human hysteromyoma tissue, human skin tissue, human stomach cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11509-1-AP targets CNN3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2068 Product name: Recombinant human CNN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC025372 Sequence: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY Predict reactive species
Full Name	calponin 3, acidic
Calculated Molecular Weight	329 aa, 36 kDa
Observed Molecular Weight	36 kDa
GenBank Accession Number	BC025372
Gene Symbol	CNN3
Gene ID (NCBI)	1266
RRID	AB_2082140
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15417
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain. CNN3 is the thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction.

Protocols

Product Specific Protocols
IF protocol for CNN3 antibody 11509-1-AP	Download protocol
IHC protocol for CNN3 antibody 11509-1-AP	Download protocol
IP protocol for CNN3 antibody 11509-1-AP	Download protocol
WB protocol for CNN3 antibody 11509-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CNN3 Polyclonal antibody (Cat# 11509-1-AP) has 7 citations published in Cell Reports, JCI Insight, Molecular Therapy Nucleic Acids, Molecular and Cellular Biochemistry, Journal of Proteome Research, Atherosclerosis Plus, and Gastroenterology Research and Practice. Research fields span inner ear cell biology, rheumatoid arthritis, pulmonary vascular calcification, ovarian cancer, ocular surface fibrosis, atherosclerosis, and gastric cancer.

Species	Application	Title
mouse	IF	Cell Rep Spatiotemporal dynamics of inner ear sensory and non-sensory cells revealed by single-cell transcriptomics. Authors - Taha A Jan View Article
		JCI Insight Lactate programs CRIP1 protein lactylation to drive synovial proliferation in rheumatoid arthritis. Authors - Meican Ma View Article
		Mol Ther Nucleic Acids circRNA CDR1as Promotes Pulmonary Artery Smooth Muscle Cell Calcification by Upregulating CAMK2D and CNN3 via Sponging miR-7-5p. Authors - Cui Ma View Article
mouse	IHC	Mol Cell Biochem STAT3 mediates ECM stiffness-dependent progression in ovarian cancer Authors - Sun Chenchen View Article
human	WB	J Proteome Res Comparative Proteomics Reveals Prolonged Corneal Preservation Impaired Ocular Surface Immunity Accompanied by Fibrosis in Human Stroma Authors - Pei-Shan Wu View Article
human	WB,IHC	Atheroscler Plus CNN3 promotes vascular smooth muscle cells proliferation and migration to deteriorate atherosclerosis by β-catenin signaling pathway. Authors - Ru-Yi Zhang KD Validated View Article

Reviews

5.0 out of 5

Add a review

1 verified customer reviews

What customers say

One reviewer (Elena S.) rated this CNN3 antibody 5 stars after using it for Western blot on MDA-MB-231 and GILM2 breast cancer cell lines at a 1:1000 dilution. She reported very strong signal with only 1 minute of exposure and low background, calling it a "great antibody." Overall, the feedback is highly positive, highlighting excellent sensitivity and clean results in WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Elena (Verified Customer) (01-31-2025)

Great antibody. CNN3 antibody was used for Western blot for two different breast cancer cell lines. Very good signal in just 1 min of exposure with low background.