• Featured Product
  • KD/KO Validated

CNPY3 Polyclonal antibody

CNPY3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 15215-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Expanded repeat-domain protein CAG/CTG 5, ERDA5, CTG4A, CTG repeat protein 4a, canopy 3 homolog (zebrafish)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, human brain tissue, A549 cells
Positive IP detected inmouse kidney tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15215-1-AP targets CNPY3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7382

Product name: Recombinant human CNPY3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 29-278 aa of BC004423

Sequence: ELGPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSPPDEL

Predict reactive species
Full Name canopy 3 homolog (zebrafish)
Calculated Molecular Weight 31 kDa
Observed Molecular Weight 30-40 kDa
GenBank Accession NumberBC004423
Gene Symbol CNPY3
Gene ID (NCBI) 10695
RRIDAB_11182172
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BT09
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for CNPY3 antibody 15215-1-APDownload protocol
IHC protocol for CNPY3 antibody 15215-1-APDownload protocol
IP protocol for CNPY3 antibody 15215-1-APDownload protocol
WB protocol for CNPY3 antibody 15215-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Cell Oncol (Dordr)

The SLITRK4-CNPY3 axis promotes liver metastasis of gastric cancer by enhancing the endocytosis and recycling of TrkB in tumour cells

Authors - Yao-Qi Zhou
humanWB,IHC

Mol Med

CNPY3's regulation of tumor microenvironment and its impact on colon cancer aggressiveness

Authors - Xucan Gao
humanWB

J Neuroimmunol

A novel rare variant of CNPY3 from familial NMOSD impairs the TLR-mediated immune response

Authors - Yongxin Mo
humanWB

Stem Cell Res

Generation of CNPY3 knock out cell line in the H1 (WA01) hESC background

Authors - Xing Qi
  • KO Validated
humanWB,IHC

World J Gastrointest Oncol

Canopy FGF signaling regulator 3 affects prognosis, immune infiltration, and PI3K/AKT pathway in colon adenocarcinoma

Authors - Xu-Can Gao
Loading...
||
New chat Able
正在加载,请稍候...