Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, human brain tissue, A549 cells |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 3 publications below |
Product Information
15215-1-AP targets CNPY3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7382 Product name: Recombinant human CNPY3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-278 aa of BC004423 Sequence: ELGPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSPPDEL Predict reactive species |
| Full Name | canopy 3 homolog (zebrafish) |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 30-40 kDa |
| GenBank Accession Number | BC004423 |
| Gene Symbol | CNPY3 |
| Gene ID (NCBI) | 10695 |
| RRID | AB_11182172 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BT09 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CNPY3 antibody 15215-1-AP | Download protocol |
| IHC protocol for CNPY3 antibody 15215-1-AP | Download protocol |
| IP protocol for CNPY3 antibody 15215-1-AP | Download protocol |
| WB protocol for CNPY3 antibody 15215-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Oncol (Dordr) The SLITRK4-CNPY3 axis promotes liver metastasis of gastric cancer by enhancing the endocytosis and recycling of TrkB in tumour cells | ||
Mol Med CNPY3's regulation of tumor microenvironment and its impact on colon cancer aggressiveness | ||
J Neuroimmunol A novel rare variant of CNPY3 from familial NMOSD impairs the TLR-mediated immune response | ||
Stem Cell Res Generation of CNPY3 knock out cell line in the H1 (WA01) hESC background
| ||
World J Gastrointest Oncol Canopy FGF signaling regulator 3 affects prognosis, immune infiltration, and PI3K/AKT pathway in colon adenocarcinoma |















