COG8 Polyclonal antibody

COG8 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 12661-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

COG complex subunit 8, DOR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, MCF-7 cells, Raji cells
Positive IHC detected inhuman ovary cancer tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

12661-1-AP targets COG8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3341

Product name: Recombinant human COG8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 394-612 aa of BC017492

Sequence: MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP

Predict reactive species
Full Name component of oligomeric golgi complex 8
Calculated Molecular Weight 612 aa, 68 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC017492
Gene Symbol COG8
Gene ID (NCBI) 84342
RRIDAB_2244993
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96MW5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The conserved oligomeric Golgi (COG) complex is an eight subunit (COG1-8) peripheral Golgi membrane hetero-oligomeric protein complex. The COG complex is organized into lobes A (COG2-4) and B (COG5-7) with COG1 and COG8 bridging these lobes and is thought to play a critical role in vesicle tethering processes (PMID: 17331980). Cog8 localizes exclusively in the Golgi apparatus and is involved in the retrograde Golgi transport of resident proteins responsible for sugar chain (glycan) biosynthesis (PMID: 17220172).

Protocols

Product Specific Protocols
IF protocol for COG8 antibody 12661-1-APDownload protocol
IHC protocol for COG8 antibody 12661-1-APDownload protocol
WB protocol for COG8 antibody 12661-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Commun Biol

Tankyrase-1-mediated degradation of Golgin45 regulates glycosyltransferase trafficking and protein glycosylation in Rab2-GTP-dependent manner.

Authors - Xihua Yue
Loading...
||
New chat Able
正在加载,请稍候...