Tested Applications
| Positive IF-P detected in | human heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| CoIP | See 1 publications below |
Product Information
11421-1-AP targets COX6A2 in WB, IF-P, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1985 Product name: Recombinant human COX6A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC029818 Sequence: MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIa polypeptide 2 |
| Calculated Molecular Weight | 97 aa, 11 kDa |
| GenBank Accession Number | BC029818 |
| Gene Symbol | COX6A2 |
| Gene ID (NCBI) | 1339 |
| RRID | AB_11232029 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q02221 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX6A2(Cytochrome c oxidase subunit 6A2, mitochondrial) is also named as COX6A, COX6AH and Belongs to the cytochrome c oxidase subunit 6A family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COX6A2 antibody 11421-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Dis FXR-regulated COX6A2 triggers mitochondrial apoptosis of pancreatic β-cell in type 2 diabetes | ||
Diabetes Increased COX6A2 promotes pancreatic β-cell apoptosis and is suppressed in diabetic GK rats after Roux-en-Y gastric bypass
| ||

