Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11437-1-AP targets COX6B2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1983 Product name: Recombinant human COX6B2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC064548 Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIb polypeptide 2 (testis) |
| Calculated Molecular Weight | 88 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC064548 |
| Gene Symbol | COX6B2 |
| Gene ID (NCBI) | 125965 |
| RRID | AB_10859092 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6YFQ2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX6B2(Cytochrome c oxidase subunit 6B2) encodes the testis-specific cytochrome C oxidase subunit VIb. It has been shown to be expressed in a subset of lung and breast tumors at a level >1% of the testicular level of expression(PMID: 24491090). It belongs to the cytochrome c oxidase subunit 6B family.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX6B2 antibody 11437-1-AP | Download protocol |
| WB protocol for COX6B2 antibody 11437-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COX6B2 Polyclonal antibody (Cat# 11437-1-AP) has 4 total citations. These appear in Biomaterials, Cell Death & Disease, International Journal of Molecular Sciences, and Journal of Biological Chemistry. The associated research fields include bone defect treatment and tissue engineering, sperm flagellum formation and male fertility, boar sperm capacitation, and glioma chemoresistance involving mitochondrial electron transport chain remodeling.
| Species | Application | Title |
|---|---|---|
Biomaterials Spatiotemporal 4D-printed shape-memory scaffold with a triple-acting liposomal strategy for the treatment of infectious bone defects. | ||
Cell Death Dis TMEM232 is required for the formation of sperm flagellum and male fertility in mice | ||
Int J Mol Sci Medium Composition Determines the Dynamics of Boar In Vitro Sperm Capacitation-Associated Events. | ||
