Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 19 publications below |
IHC | See 3 publications below |
IF | See 2 publications below |
Product Information
11416-1-AP targets COX7A2L in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1980 Product name: Recombinant human COX7A2L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC007095 Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK Predict reactive species |
Full Name | cytochrome c oxidase subunit VIIa polypeptide 2 like |
Calculated Molecular Weight | 114 aa, 13 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC007095 |
Gene Symbol | COX7A2L |
Gene ID (NCBI) | 9167 |
RRID | AB_2245402 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14548 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c oxidase (COX) is the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. The mitochondrially encoded subunits function in electron transfer, and the nuclear encoded subunits may function in the regulation and assembly of the complex. COX7A2L (cytochrome c oxidase subunit 7A-related protein), also known as COX7AR or COX7RP, is an inner mitochondrial membrane protein. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. Recently it was found that DNA methylation of COX7A2L had a significant association with therapy response in patients with breast cancer. In Alzheimer's disease the expression of COX7A2L was reduced.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for COX7A2L antibody 11416-1-AP | Download protocol |
IHC protocol for COX7A2L antibody 11416-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Science Supercomplex assembly determines electron flux in the mitochondrial electron transport chain. | ||
EMBO J Multiple pathways coordinate assembly of human mitochondrial complex IV and stabilization of respiratory supercomplexes. | ||
Cell Rep Human COX7A2L Regulates Complex III Biogenesis and Promotes Supercomplex Organization Remodeling without Affecting Mitochondrial Bioenergetics.
| ||
Free Radic Biol Med Cardioprotective strategies preserve the stability of respiratory chain supercomplexes and reduce oxidative stress in reperfused ischemic hearts. | ||
Cell Rep COX7A2L Is a Mitochondrial Complex III Binding Protein that Stabilizes the III2+IV Supercomplex without Affecting Respirasome Formation. | ||
J Pathol Clinical response to chemotherapy in oesophageal adenocarcinoma patients is linked to defects in mitochondria.
|