Use Able AI chat for product recommendations

COX8A Polyclonal antibody

COX8A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15368-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

COX8, COX8 2, COX8L, Cytochrome c oxidase polypeptide VIII-liver/heart, Cytochrome c oxidase subunit 8-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, human skeletal muscle tissue
Positive IHC detected inmouse heart tissue, human hepatocirrhosis tissue, rat heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15368-1-AP targets COX8A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2885

Product name: Recombinant human COX8A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-69 aa of BC063025

Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE

Predict reactive species
Full Name cytochrome c oxidase subunit 8A (ubiquitous)
Calculated Molecular Weight 8 kDa
Observed Molecular Weight 8 kDa
GenBank Accession NumberBC063025
Gene Symbol COX8A
Gene ID (NCBI) 1351
RRIDAB_10697832
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10176
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX8A(Cytochrome c oxidase subunit 8A) is also named as COX8, COX8L and belongs to the cytochrome c oxidase VIII family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. The gene encodes a full length protein of 8 kDa with a transit peptide of 25 amino acid.

Protocols

Product Specific Protocols
IHC protocol for COX8A antibody 15368-1-APDownload protocol
WB protocol for COX8A antibody 15368-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Cell Death Dis

O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma.

Authors - Weicheng Wu
humanIHC

J Proteomics

MALDI-MS tissue imaging identification of biliverdin reductase B overexpression in prostate cancer.

Authors - Pallua Johannes Dominikus JD
mouseWB,IF

J Adv Res

Lactational high weight loss impairs follicular development by causing mitochondrial dysfunction of ovarian cells in sows and mitigated by butyrate supplement

Authors - Kexiong Liu
ratWB

Basic Res Cardiol

Comparison of the stage-dependent mitochondrial changes in response to pressure overload between the diseased right and left ventricle in the rat

Authors - Ling Li
humanWB

Pharmacol Res

Discovery of KMT5A repressed miR-99b cluster with potential to restore chemotherapy sensitivity in gastric cancer by regulating mitochondrial complex II and affecting OXPHOS.

Authors - Liaoran Niu
mouseWB

Nat Commun

A FRET-based respirasome assembly screen identifies spleen tyrosine kinase as a target to improve muscle mitochondrial respiration and exercise performance in mice

Authors - Ami Kobayashi

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Svitlana (Verified Customer) (03-01-2019)

HEK293t transfected with Cox8-eGFP, 48 hours post-transfection cells collected for mitochondria isolation. 10 ug mitochondrial lysate (in RIPA buffer) was loaded per line.Incubation with primary anti-Cox8 antibody overnight at 4C.Image: 1st line protein ladder, 2nd line no-transfection sample, 3rd line Cox8-eGFP transfected sample.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293t
COX8A Antibody Western Blot, validation (1:1000 dilution) in HEK293t (Cat no:15368-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...